®
CLEANING
SYSTEMS
PRODUCT CATALOG
• Supplies • Accessories • Equipment
For CARPET, UPHOLSTERY, WALL and CEILING Cleaning and Restoration
Table of Contents
Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Cost Comparison . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7
Detergents, Pre Treatments and After Treatments . . . . . . . . . . . . . . . . . . 8 Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 General Advertising and Printed Material . . . . . . . . . . . . . . . . . . . . . . . 20 Equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 VON SCHRADER AFFILIATIONS
• Champion Status E.P.A. SDSI
• International Sanitary Supply Association
• Racine Area Manufacturers and Commerce
• Wisconsin Better Business Bureau
• Low Moisture Carpet Cleaners Association
• The WOOLSAFE Organization
• Green Seal
2
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Introduction
Von Schrader Quality Commitment
Wewillprovidecustomerswiththeinteriorcleaning
systems, skills and confidence in order for them to
performtotheirmaximumefficiencyandtoprovide
premiumperformancecleaningsystemstoinstitutions
worldwide.
Wewillshipfilledordersonasameornextdaybasis
andpreservecustomerconfidenceinawaythatenables
ourcustomerstoassuretheircustomersofhighquality
performance.
Why Von Schrader Can Assure You of the Finest Equipment AllVonSchradermachinesaremanufacturedinourownfactoryshownhere.Ithousesourgeneralofficesandmanufacturing
facilities,aswellasourschool,research,chemicalsandqualitycontrollaboratories.Notradeschoolcouldofferyoua
morecompetent,morededicatedstaffofexpertconsultants.They’reatyourservicenow.
We Build Our Own Parts With few exceptions, we manufacture all parts and electrical
motors that go into our equipment. We also develop and
manufacture all detergents used
in our machines. Because of
this personal control and our
constant collaboration with the
technical staff of major fiber
and carpet manufacturers, we
areaheadofthetimesandcanassure
our customers of the newest
andfinestqualityproducts.
Von Schrader Products Used Worldwide Ourmachinesanddetergentsareshippedallovertheworld.Infact,muchofourtotalproductiongoesto52different
foreigncountries.
Peopleinfarawaycountriesneedequipmentthat’sefficient,dependableandtrouble free,soit’sonlynaturalthey’ve
chosentobecomeassociatedwithVon Schraderinordertodothefinestworkonagreatvarietyofunusualanddelicate
fabricsandsurfaces.
Huge Stocks of Supplies Wemaintainacompleteinventoryofsuppliesinourshippingroomandwarehousetoinsurefastdeliverytoallpartsof
theworld.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
3
What You Should Know About Von Schrader Detergent VonSchraderDetergentscontainastate-of-the-artpolymerbarrier.Thisdry,nonresoilingprotectorpreventstheoily,
difficult-to-cleansoilfromattachingitselftofibers.Nowroutinevacuumingbecomesmoreeffectiveandgradually
removesthebarrieralongwiththeoilysoil.Carpetstayscleanlongerandiseasiertocleannexttime.Theanionic
barrierworkswithotherprotectivetreatmentsthatmaybebuiltintoorsprayedonthecarpet,too.
VonSchraderSuperConcentrateisanindustryleadingvalue,aswellasa
high performance detergent. When you compute the cost per gallon of
readytousesolutionandseehowmanysquarefeetoffabricyoucanproduceinashorttime,you’llknowthatthispremiumproductisactuallyless
expensivetousethancheaper,watereddownbrands.Thereisnosubstitute
forquality.
VonSchraderLowMoistureSoilExtractiontechnologyusesdenseaircell
bubbleswhicheffectivelysuspends(emulsifies,absorbsandholds)soilfor
immediate extraction. The combination of millions of dense “power
bubbles” with instant extraction prevents soil from being redeposited on
fibers,ashappenswithcleaningthatistoowet.
Von Schrader’sdetergenthasfastdryingactionwhichmakesitpracticaltocleananytimewithouttheinconvenience
ofalongdryingperiod.WorkingtogetherwithaVonSchradermachineasanintegratedsystem,VonSchraderdetergent
deliversdeep-down,longlastingcleaning.
We’re Green and Certified — Von Schrader manufactures products that are:
Safer for People, Pets, Carpet, Upholstery and the Environment .
Certified
Avoids
Economical Non Toxic
Green
Mold & Mildew Energy
Compliance Allergens
Usage
Chemical
Fumes
Enhances
Anti
Conserves
Indoor
Air Quality
Resoiling
Water
Usage
Low
Reduces
Initial &
Downtime
Ongoing Cost
Our cleaning process uses gentle, biodegradable, non-toxic and fragrance-free surfactants that leave no
stickyoroilyresiduetoattractandholdsoil.
• Champion Status E .P .A . SDSI
• Woolsafe approved
• Boeing Aircraft approved
• Green Seal Certified
• Carpet Mill recommended
The advantage of this system is that because of the small amount of water used there is less chance of over-wetting or
damagetothebacking.Thisisparticularlyimportantonwovencarpets.Dryingtimeisalsolesswiththismethodthan
withhotwaterextraction.
Tested by Cleaning Research International in accordance with NZWB Test Methods and suitable for use on
100%WoolandWoolrichcarpets.
Green Seal, Inc. certifies that the following product complies with Green Seal’s Environmental Standard
forGeneral-Purpose,Bathroom,Glass,andCarpetCleanersUsedforIndustrialandInstitutionalPurposes{GS-37}
andislicensedtousetheGreenSealCertificationMark:Von SchraderAntiResoilCarpet&UpholsteryDetergentand
Von SchraderAntiResoilCarpetDetergent.
4
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Environmentally Responsible Products
Von Schraderproductshavealwaysbeenenvironmentallyresponsible/sensitive,effectiveandsafefortheuser.
Werecognizeconsumerconcernsabouthowourproductsaffectyou,theenvironmentandindoorairquality.
Providingyouwithhighquality,safeandperformancereliableproductswillalwaysremainaprimecompany
objective.
Products labeled with the GENUINE ADVANCED AIR CELL FORMULA Seal of Approval are:
• DesignedexclusivelyforVonSchradercleaningsystems.
• State-of-the-art,withuniqueAirCelltechnologytoprovideoutstandingperformanceandmaximumefficiency.
• Antiresoiling,encapsulating,fastdrying,environmentallyresponsible,fragrancefree,andmadewith
biodegradablesurfactants.
• Apartofanintegratedsystemthatprovidesdeepdown,longlastingcleaning.
• Thehighestqualityandthebestvalue.
• GreenSealCertified
• WoolSafeapproved
• CarpetMillrecommended
• ChampionStatusE.P.A.SDSI
• BoeingAircraftapproved
Make a Residue Test
1. Prepare 3 different detergent solutions according to manufacturer’s directions (use Von Schrader detergent for one
ofthem).
2. Pourasmallamountofeachdilutedsolutionintoaseparatesaucerorashtray.
3. Allowallthewatertoevaporate,orplaceinawarmovenuntilallwaterdisappears.
4. Scrapetheremainingresidueswithapenknifeorfingernail.VonSchraderresiduewillbreakupcrisplyintofineparticles.
Highresoildetergentresidueswillrollintogummy,tackylumpsthatquicklypickuptrafficsoil,resultinginfastresoiling
aftercleaning.
NumberOnewascleanedwithasteammachine(hotwater
extractionanddetergent);NumberTwowitharotarybrush
machine;NumberThreewithadryfoammachinewithbuiltin
vacuumtoremovesoil;NumberFourwithareeltypemachine
withoutvacuumpickupandstockdetergent;NumberFiveserved
asthecontrolpieceandwasnotcleanedorexposedtofoot
trafficorsoiling.
Tofurthertesttheresoilcharacteristicsofon-location
carpetcleaningandmaintenance,fourpiecesofclean
whitecarpetwerecleanedwithwidelyuseddetergents
andsystemsbeforebeingexposedtosoiling.
Thefourcleanedsamplesweretapedtothefloorinaheavily
traffickedcorridorleadingtoandfromafactoryentranceway
area.Aftertwoweeksofheavysoilinganddailyvacuuming,
thesampleswereremovedforsoilaccumulationevaluation.
Themicroscopephotographstellthestory.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
5
AFTERSOILINGimageofthemostheavilysoiledSample#1clearlyshowstheeffects
ofthestickydetergentresidueleftonthefibersthatattractedandheldlargeandsmallsoil
particles.Becausethedetergentleftaheavystickyresidue,soilparticlesattachedthemselvesquicklyandtenaciouslytothefibersandcausedthecarpettoresoilmorerapidly.
AFTER SOILING image of the least soiled Sample #3 shows less soil, small soiling
particulates, and a low resoil rate. This detergent and the Von Schrader Low Moisture
ExtractionSystem™keptthecarpetcleanerduringtheentiretestperiod.Cleanercarpets
savemaintenancetimeandcostsbyextendingthetimebetweencleanings.
CLEAN CONTROL image of Sample #5 …never cleaned, never walked on… looks
almostthesameasSample#3.
Performance
Illustratedaretwosectionsofapieceofcarpet.Section2
wascleanedwithVon Schraderdetergent,andSection1was
cleanedwithanotherdetergent.Thecarpetwasplacedina
factoryentranceway,turnedend-to-endeachdaytogetequal
soildistributionandwear.Itwasvacuumedattheendofeach
dayfor21days.Theunretouchedimageclearlyshowsthe
superiorsoilresistanceoftheVonSchradercleanedSection2.
Von Schrader Air Cell Technology
Minimizes Moisture! Avoids Over Wetting!
Air Cell Bubbles
help overcome gravity,
control moisture
and suspend soil.
Plus, it’s anti-resoiling.
Microscopically thin layer
of our advanced cleaning
formula deep cleans and
encapsulates to trap and
hold dirt.
6
Wetness Comparison
Each photo shows what happens when air cells or liquid are applied to paper napkins by two different methods of extraction cleaning .
30 seconds elapsed time
Air Cell Controlled
Liquid Loss of Control
AirCellExtraction™technologyusesthousandsoftiny
AirCellswhichare90%airandonly10%moisture.Notice
thelimitedwettingandmigrationofAirCellsontheleft
comparedtoanequalvolumeofcompetitivesolutionon
theright.AirCellscontrolthecleaningprocessand
problemsassociatedwithoverwettingcarpet.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Cost Comparison
CostperGallon
(ForExample)
$10.00
÷
÷
Facts About the Real Cost of a Product
No.ofDiluted
Gallons
33(32to1)
=
=
CostofDiluted
Gallons
$.3030
÷
÷
SquareFeet
ofCoverage
100sq.ft.
=
=
Costinuse
persquarefeet
If cleaning price per square foot is $.35, then $.007, the For Use in Your Low Moisture Soil Extraction Carpet
cost of chemical per square foot, represents two percent Cleaning System
of the cleaning price or two pennies of each cleaning
Atadilutionrateof4-6ouncespergallonofwater,Von
dollar.
SchraderhighandlowpHdetergentscostless(evenwhen
Manpower(labor)costtodaywillvaryfrom25%TO35% shippingchargesareadded),becauseyougetmoresquare
ofthecleaningprice.Twothingsbecomeapparentfrom feetpergallonofconcentrate—3,200squarefeetonthe
averagewithVonSchrader.Becauseofitsuniqueformulathesefigures:
tionresoilrateislowands-l-o-w.Ithasapleasantsmell
1.Cheaperchemicalsdonotofferanysignificantsavings. andisnon-allergenic.Itisnon-corrosivetoyourequipment.
EventotaleliminationofchemicalcostwouldnotrepreKeepthisinmindwhenlookingatalternativedetergent
sentasignificantsavings.
products.Remember,Von Schraderproductsaredesigned
2.Higherqualitychemicalsreducethetimeonthejob tobeusedinconjunctionwithVon Schraderequipmentas
anintegratedsystem.
(labor),andthatsavingsissignificant.
Cleans
56Sofas
at$65.00each
Or
1gallonof
Von Schrader
detergent
CleansApprox.
125Chairs
at$29.00each
$3,640 .00
Your Gross Profit
$3,625 .00
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
7
Detergents, Pre-Treatments & After-Treatments
Von Schrader Anti -Resoil Super and ULTRA Carpet & Upholstery Detergent
General Description: ALowpHDetergentConcentrateformulatedforpro(Blue Label) fessional Low Moisture Extraction cleaning of wool, cotton, natural fibers
andupholsteryfabrics.Anti-resoilcharacteristicsarebuiltintothisdetergent.
When to Use: Whencleaningallnaturalfibercontentcarpetandupholsteryfabrics:wool,cottonandblends.Wherethefibercontentisunknown
orsuspectedtocontainnaturalfibers,theVon SchraderLowpHDetergent
willgiveoptimumperformancewithahighmarginofsafety.
Why to Use: Itissafeforallcarpetfibers.Withappropriatecolortests,Low
pHDetergentcanbeusedonmostvaluableanddelicateorientalordomestic
carpetandupholstery.
Physical Data:
SuperConcentrateDilutionRatio:21:1to32:1(4to6oz.detergentper
gallonofwater).
ULTRAConcentrateDilutionRatio:64:1(2to3oz.detergentpergallon
of water). One gallon liquid will produce enough solution to clean approx.6,400sq.ft.ofcarpetorequivalentupholsteryarea.pHFactors:8.0
(inconcentrateform)7.5(indilutedsolution)
Haitian Cotton Detergent
General Description: AnextremelydryfoamdetergenttosafelycleanHaitian
Cottonorotherfinefabricswithoutthedamagesofbleedingorbrowning.
When to Use: UseforcleaningallHaitianCottonFabric,aswellasHaitian
orotherfine,delicatefabricswhenoverwettingmightbeaconcern.This
productcanalsobeusedextremelywellandeffectivelyinremovingcoffee
stainsfromfabricorcarpetfiber.
Why to Use: Preventsbrowningproblemsnormallyassociatedwithoverwetting.Thisalsocanbeusedforcorrectivemeasureforexistingbrowning
conditions.
Leather Lather
General Description: Leather Lather has been pH balanced and formulated
toeffectivelycleanalltypesofsmoothly,finishedleatherfurnitureand
vehicleinteriors.
When to Use: Usewhencleaningfinishedleatherupholsteryorgoods.
Why to Use: ForsafeandeffectivecleaningofleatherusingtheVonSchrader
UpholsteryLowMoistureSoilExtractionSystem.
Also available in Leather Care Combo Pak .
Leather Lotion
General Description: Leather Lotion safely strengthens, preserves and
nourishesfineleather.It’sarichcreamyliquidthatisspeciallyformulated
forsmooth,finishedleatherupholstery.
When to Use: Foruseduringoraftercleaningfinishedleatherupholstery.
Why to Use: Torestoreandconditioncleanedleatherandrestorenatural
oilsinthecleaningprocess.
Also available in Leather Care Combo Pak .
Applicator Mitt for Leather Lotion
General Description: Washableheavy-dutyabsorbentcottonmitt.Used
toeasilyapplyLeatherLotionandalsobuffthesurfacewhendry.
When to Use: Foruseduringoraftercleaningfinishedleatherupholstery.
Why to Use: Torestoreandconditioncleanedleatherandrestorenatural
oilsinthecleaningprocess.
Also available in Leather Care Combo Pak .
Leather Care Combo Pak
Contains:16oz.LeatherLotion,1qt.LeatherLather,ApplicatorMitt General Description: LeatherLatherhasbeenpHbalancedandformulated
toeffectivelycleanalltypesofsmoothly,finishedleatherfurnitureandvehicle
interiors.LeatherLotionsafelystrengthens,preservesandnourishesfine
leather.It’sarichcreamyliquidthatisspeciallyformulatedforsmooth,
finishedleatherupholstery.
When to Use: Usewhencleaningfinishedleatherupholsteryorgoods.
Why to Use: Forsafeandeffectivecleaning,restoringandconditioningof
leatherusingtheVonSchraderUpholsteryLowMoistureSoilExtractionSystem.
8
Packaging: Super Concentrate
StockNo.Description
C214Carton,1galloncontainer
C161Carton,4x1galloncontainers
Packaging: ULTRA Concentrate
Reduces Freight Cost
StockNo.Description
C345Carton,2-1/2galloncontainer
F3345Carton,2x2-1/2gallon
containers
Physical Data: DilutionRatio: 4:1(4partswaterto1
partcleaningsolution
concentrate)
pHFactors: 6.0(inconcentrateform)
5.5(indilutesolution)
Packaging: StockNo.
Description
C1635
Carton,1galloncontainer
Physical Data: DilutionRatio: 5oz.ofliquidcleanerto
1gallonofwater
pHFactors: 8.0(indilutesolution)
Packaging: StockNo.
Description
C1767
Carton,1qt.container
C1766
Carton,6x1qt.container
Physical Data: DilutionRatio: LeatherLotionisapplied
fullstrength
pHFactors: 7.0(insolutionform)
Packaging: StockNo.
Description
C1769
Containerwithfliptopcap
C1770
Carton,6x16oz.container
Packaging: StockNo.Description
C1778 ApplicatorMittfor
LeatherLotion
Packaging:
StockNo.Description
C1768 Carton,CombinationPak,
LeatherLotion16oz.
container,LeatherLather
1qt.container,Application
Mitt
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Von Schrader Anti -Resoil Super and ULTRA Carpet Detergent (Red Label) General Description: AHighpHDetergentConcentrateformulatedfor
professionalLowMoistureSoilExtractioncleaningofallsynthetic(manmade)fibercarpets.BlendedtoperformwellinVon SchraderLowMoisture
SoilExtractioncleaningequipmentevenwithfairlyhardwater.Anti-resoil
characteristicsarebuiltintothisdetergent.Safeforuseonstainresistcarpet.
When to Use: Whencleaningallsynthetic(man-made)fibercarpets:nylon,
acrylic,polypropyleneandstainresist.
Why to Use: Itissafeforallsyntheticandstainresistcarpetfibers.When
comparingVon SchraderDetergentwithothers,besuretoworkyourcost
outtopricepergallonofpreparedsolution.HighpHDetergentcanbediluted
upto32gallonsofwaterpergallonofconcentrate,givessuperiorcoverage
andhasgreatercleaningcharacteristicsthanotherbrands.
Physical Data:
SuperConcentrateDilutionRatio:21:1to32:1(4to6oz.detergentper
gallonofwater).
ULTRAConcentrateDilutionRatio:64:1(2to3oz.detergentpergallon
ofwater).Onegallonliquidwillproduceenoughsolutiontocleanapprox.
6,400 sq. ft. of carpet or equivalent upholstery area. pH Factors: 9.1 (in
concentrateform)8.9to9.1(indilutesolution)
Packaging: Super Concentrate StockNo.Description
C120Carton,1galloncontainer
C162Carton,4x1galloncontainers
Packaging: ULTRA Concentrate
Reduces Freight Cost StockNo.Description
C349Carton,2-1/2galloncontainer
F3536Carton,2x2-1/2gallon
containers
Grease Lightning Restaurant Carpet Detergent Physical Data: Dilution 21:1to32:1(4to6oz.
General Description: Speciallyformulatedtoperformexceptionallywell
ongreasyoilyrestaurantcarpet.It’sacitrusscented,powerfoamdetergent
concentratedevelopedexclusivelyfortherestaurantandcommercialmarket.
When to Use: Forcleaningcarpetwithextremesoilingconditionssuchas
deeplyembeddedcookinggreaseorground-inoilydirt.
Why to Use: You needthisextrapowerfulproducttobeabletoemulsify
andremovethetypeofsoilingthatexistsonrestaurantcarpet.Savescleaning
time.Covers3,200sq.ft.pergallon.
Powder Carpet and Upholstery Detergent General Description: AcombinationofbothHighpHandLowpHDetergent
inpowderdetergentconcentrateform.Whenweightofashipmentisafactor,
thePowderDetergentConcentratehasacostadvantage.
When to Use: Whencleaningallnaturalfibercontentcarpetandupholstery
fabricssuchaswool,cottonandsyntheticblends.
Why to Use: Itissafeforallfibers,bothsyntheticandwoolorothernatural
fibers.ThePowderDetergentConcentrateismadeintoaslurryandthen
addedtofullmeasureofwaterperinstruction.Veryeconomical.
Ratio:
detergentpergallonofwater)
pHFactors:9.0(indilutesolution)
Packaging:
StockNo. Description
C122
Carton,1galloncontainer
C169
Carton,4x1galloncontainers
C127
Carton,2-1/2galloncontainer
C1941
Drum,15gallons
Physical Data: Dilution2or3tablespoonsofconc.
Ratio:pergallonofwater.Makes
150gallonsofsolution,enough
tocover15,000sq.ft.ofcarpet
orupholsteryarea
pHFactors:9.0(inconcentrateform)
8.0(indilutesolution)
PR30Carton,6lbs.
BLOCKADE®Advanced Formula Carpet Protector Concentrate
General Description: BLOCKADE® Carpet Protector is a specially
developedfluorocarbonchemicaltoprotectcarpetsfromwetanddrysoil.
Aprotectivetreatmentaftercarpetcleaningformsaninvisibleshieldaround
eachfibertoresistsoilandstains.Itleavesnosolventodor.
When to Use: BLOCKADE®CarpetProtectorisappliedbyasprayapplicationsuchastheC1130Sprayerafteracarpethasbeenproperlycleaned.
Why to Use: BLOCKADE®willkeepcleanedcarpetslookingcleaner
longer,helpextendthelifeofthecarpetandallowquickandeasycleanup
ofaccidentalspills.
Wall Cleaning Detergent
General Description: Professional Wall Cleaning Detergent Concentrate
whichcomesinaliquidorpowderform.IntendedforusewiththeVS3
PowerWallCleaningSystemorVersaTile®System.
When to Use: Excellentforcleaningandrestoringinteriorwallsurface.
Why to Use: Powder Detergent is an old standby of many years. Like
powdercarpetdetergent,ittakesabitlongertoprepareforuse.Theformula
forLiquidWallDetergentresultsinaverylightfoamingactionthatclings
towallsandceilingsuntilremovedbythebuffinggliderandhaslesstorun
ordrip.Cleaningcapabilityisequalforbothtypes.
Physical Data: Dilution 1partBlockadeto2-4parts
Ratio:
water.Enoughtoprotect
approximately1,200sq.ft.
ofcarpet.
pHFactors:4.0to5.0
Packaging: StockNo.Description
C1637 Carton,1galloncontainer
C264
Carton,4x1galloncontainers
Liquid Wall Detergent Physical Data: Dilution 21:1to32:1(4to6oz.conc.
Ratio:
toeachgallonofwater)
pHFactors:9.5(indiluteform)
Packaging:
StockNo. Description
C920
Carton,1galloncontainer
C245
Carton,2-1/2galloncontainer
C171
Carton,4x1galloncontainers
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
9
“Power Pak” Acoustical Tile Cleaner
General Description: Asuperconcentratedpre-measureddetergentformulatedforprofessionalacousticaltilecleaning.
When to Use: Tocleanstainsonalltypesofporousandnon-poroustile
causedby:grease,smoke,soot,soil,cigarettetar,nicotineandnormal
discoloration.
Why to Use: Fastandconvenient.Pre-measuredfoil“PowerPak”empty
directlyintosolutionmoduleforfast,one-stepmixing.Restoresacoustical
capabilities.Improvesfire-retardantqualities.Brightenswhileitcleansand
deodorizes.Noneedtowipetheporousceilingtilesurfacesafterapplication.
Fusion™ Dual Action Power Cleaner
General Description: Forthosewhopreferaspeciallyformulatedsurfactant-based two-part liquid concentrate. This pH balanced solution is for
alltypesofporousandnon-porousacousticaltilecleaningandmore.
When to Use: Alsocleanswalls,brick,stoneandmarble.It’sespecially
effectiveonsilkplants,mini-blinds,chandeliersandevenmoviescreens.
Why to Use: Two-partpackage:12-ouncePOTENTCONCENTRATEand
12-ounceSUPERCHARGEDACTIVATOR.Environmentallysafetouse,
nontoxicandbiodegradable.Mixedsolutionwillnotdamagecarpet,draperies,
floorsorothersurfaces.
Liquidator Concentrate
General Description: Liquidator is used to break down the soil-laden
recovered foam from the Von Schrader Carpet & Upholstery Cleaning
Systems. When to Use: Wheneveremptyingarecoverytank,Liquidatorshouldbe
usedwithasmallamountofwatertobreakdownthesoil-ladenfoamintoa
liquidstate.
Why to Use: By using Liquidator, moisture will not enter the motor,
nor will it allow ”spitting” to occur with the equipment.The use of
Liquidator will eliminated the continual emptying of recovery tanks
fromabuildupoffoam.Onequartofdilutedsolutionwilldefoam10-15
gallonsofrecovereddirtysolution.
Physical Data: Dilution 1pouchto4gal.ofwater.
Ratio:
Cleansupto3,000sq.ft.
pHFactors:8.0(indiluteform)
Packaging:
StockNo. Description
C1671
Carton,4x30oz.pouches
C1697
Carton,4-4x30oz.pouches
C16004 Carton,1x30oz.pouch
Physical Data:
Dilution 12oz.ofconcentrateand
Ratio:
12oz.ofactivatorto1gal.of
watercleans800sq.ft.
pHFactors:13.1(indilutesolution)
Packaging: StockNo. Description
10033
Carton,4x12oz.liquidconc.
and4x12oz.activator
Physical Data: Dilution 64:1(1tablespoonperquart
ofwater)
Packaging: StockNo.Description
C1951Carton,8oz.container
C1952Carton,3x8oz.containers
BeFore™ Pre-spray Concentrate for Carpet
General Description:A potent pre-emulsifier with additives to help
prepare imbedded grease, oil and heavy traffic lane soil for removal.
Appliedasaspraypriortocleaning.Beforehelpspenetratefoamresistant
oil and grease layers. Produces better cleaning results faster. Safe for
StainResistCarpet.Notadvisableforuseonupholsteryfabric.
When to Use: Whentrafficlanesareoilorgreasecoated,asinrestaurants,
shops,officedoorways,entryways,autoshowrooms,grocerystores,etc.
Why to Use: Pre-emulsifies(softens)heavygreaseimpactedsoiltomake
itmoreeasilypenetratedbyfoamandbrush.
Physical Data: Dilution4:1(32oz.conc.pergal.ofwater)
pHFactors:9.2
Packaging: StockNo.Description
C1105Carton,1galloncontainer
C246Carton,2-1/2galloncontainer
C165Carton,4x1galloncontainers
C115515gallondrum
PRELIM™ Upholstery Pre-spray Concentrate
General Description: A pre-spray concentrate specially formulated to
loosenstubborn,heavysoilfromevendelicateupholsteryfabrics.Hasapleasant
citrusfragrancethatwillcontinuetolingeraftercleaninghasbeencompleted.
When to Use: Prelimshouldbeusedpriortocleaninganyheavilysoiled
fabricasapre-spraytreatment.Allowtodwell10minutespriortoactualcleaning. Why to Use: Time-saving Prelim will reduce the need for spotting and
attendantabrasion.Itmakesexcessivebrushingorcleaningunnecessary.
theconcentratedpre-sprayPrelimcanbedilutedtosuitanyconditionfor
maximumeconomy. 10
Physical Data: Dilution 10:1to5:1(mix13-25ounces
ofPrelimwitheachgallonof
waterdependingondegreeofsoil)
pHFactors:7.3(inconcentrateform)
6.7(indilutesolution)
Packaging: StockNo.Description
C1659 Carton,1galloncontainer
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Fabric Protector
General Description: Afluorochemicalbasedsprayapplicationtoprovide
protectionagainstdirt,greaseandstainsfromspillsonupholsteryandother
fabrics.Safeforallcolorfastmaterial.Willnotfreeze.Quickdryingtime.
When to Use: Useonnewfabricorfreshlycleanedfabrictoextendthe
lifeofthefabric,aswellasdurationbetweencleanings.
Why to Use: Formsaninvisiblebarrierwhichkeepsspillsfrombeingabsorbed
intothefabric.Spillssimplybeaduponthesurfaceandcanbewipedaway
easily.Normalvacuumingwillremovemostdirt,maintainingthefabric’s
freshappearance.
Physical Data: Dilution NodilutionrequiredUseproduct
Ratio:
straightfromthebottle.1quart
covers9sq.yards.Productcan
beappliedbyhandheldpump
sprayerorairlesselectricsprayer.
pHFactors:6.0(indiluteform)
Packaging:
StockNo. Description
C1639 Carton,1quartcontainer
Un-Duz-It
General Description: Bio-Enzymatic pet odor decontaminant and pet
stainremover. When to Use: Tocorrectpetodorproblemsoncarpet,drapes,upholstery,
mattresses,wood,plastic,clothing,containers,etc.
Why to Use: Utilizesenzymesascatalyststohelpbreakdownorganicrelatedodorsandstaining.Providespermanentodorcontroltodeterfuture
petdeposits.
Microban X-590
General Description: Water-based,bactericide,fungicide,deodorant,and
insecticideallinoneuniqueformulation.Oneapplicationkillsinsects,mold,
mildew,bacteriaodors,andprovideslong-lastingresidualprotection.E.P.A.
approvedforbothsprayandULVfogapplication.Protectsstoredfabrics
againsttextiledestroyinginsectsforsixmonths.
When to Use: For sewage backups, toilet overflow problems, walls,
floors,etc.Alsokillsinsectsandtheirlarvae.
Why to Use: E.P.A.approved,provideslong-lastingresidualprotection,
controlsmoldandmildewproblems.
Odor Exploder®
General Description: OdorExploderwillneutralizethedisagreeableodors
frompets,saturatedstalefoododors,smokeodorafterfires,furnacebackups,
smokyfireplaces,andotherodorsnotcausedbymoldormildew,aswell
asbacterialgrowth.Thisisnotamaskingagentbutanodorcounteracter.
When to Use:Concentratecanbeaddedtoacleaningsolutionormistedin
theair,aswellasbeinginjectedinto“smelly”carpet,furniture,orexposed
surfaces.
Why to Use: OdorExploderwillcounteractodorsandcanbedoneefficientlybymeansofasprayerapplicationoraddeddirectlytoyourcleaning
solution.
Professional Spot Removal Kit
General Description: This kit consists of nine different spotting agents
plusequipmenttoapply,treatandremovechemicalsandspots.Complete
spottingguideinthecoverandaseparateguideareincluded.
When to Use:Useasdirectedinthespotremovalguide.Thecontentsof
thisprofessionalkitwillhelptocreateanearlyspot-freecarpet.
Why to Use: Eliminatingdifficultspotsfromcustomer’scarpetswillincrease
customersatisfactionandyouradd-onserviceincreasesyourprofits.
Stock No . C520 includes the list of products to the right (in8&10oz.sizes).
Volatile Solvent
General Description: Arapiddryingsolventspotterfortoughpetroleumbasedstainsincarpetandupholstery.Driesquickly.
When to Use:Toremovegrease,oil,tar,gum,latexadhesive,lipstick,shoe
polish,ink,nailpolish.
Why to Use: Safetouseonallfabrics,carpetsandfibers.Leavesnoresidue.
Physical Data: Dilution 1partUn-Duz-Itto1-2parts
Ratio:
water.
Packaging:
StockNo. Description
C1796 Carton,1galloncontainer
C1795Carton,4x1galloncontainers
Physical Data: Dilution Usefullstrength.Donotdilute.
Ratio:
Covers1,500sq.ft.ofporous
surfacepergallon.Applyvia
sprayer.
Packaging:
StockNo. Description
C1794 Carton,1galloncontainer
C1793Carton,4x1galloncontainers
Physical Data: Dilution General purposes add 1 to 5
Ratio:
oz.tocleaningsolution.Fogging
ormistinguse1pintto5gallons
ofwater.
pHFactors:8.5(inconcentrateform)
7.0(indilutesolution)
Packaging:
StockNo. Description
C873
Carton,4x8oz.containers
C860Carton,12x8oz.containers
GITGO
DYE-OUT
COFFEEBREAK
SpotRemover
OdorExploder
RustRemover
EnzymeDetergent
VolatileSolvent
Physical Data: Dilution Nodilutionrequired.Use
Ratio:
productstraightfromthebottle.
Packaging:
StockNo. Description
C1748 Carton,1quartcontainer
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
11
Rust Remover
Physical Data: Dilution Nodilutionrequired.Use
Ratio:
productstraightfromthebottle.
pHFactors:2.0
Packaging: StockNo.Description
QRR
Carton,1quartcontainer
Enzyme Detergent
Physical Data: Dilution 1teaspoonto4oz.ofwarm
Ratio:
water.
pHFactors:9.0to10.0
Packaging: StockNo.Description
C1747 Carton,6oz.container
General Description:Attacksandremovesruststainsfrommostsurfaces.
When to Use: Canbeusedtoremoverustoncarpeting,upholstery,tilewalls
orconcretefloors.
Why to Use: Nostrong,damagingacidsareused.Safe,non-flammable.
Rustischemicallybrokendownandreleasedfromthesurface.
General Description:Adry,granularthat’sdissolvedinwarmwaterto
helpbreakdownprotein-basedsoilsoncarpetandupholstery.
When to Use: Toremovegravy,blood,feces,milk,egg,vomit.
Why to Use: Willnotnormallyharmsurfaces.
GITGO Gum, Ink, Tar, Grease and Oil Remover
General Description:Effectivelyremoves:chewinggum,ink,tar,grease,
oil, glue adhesives and other stubborn spots from carpet and upholstery.
containsasafecitrussolventthatchangesfromaliquidtoageloncontact.
When to Use: Excellentwhenremovinggum,ink,tar,grease,oilspotsthat
donotcomeoutwithregularcleaningorgeneralspotremover.
Why to Use: GITGOremainsontopofthespotandthesurface,removing
the spot without penetrating, damaging or soaking the backing since
itisinagelform.Chancesofspotsreturningthroughwickingarerarewhen
usingGITGO.
DYE-OUT
General Description: Effectively removes artificial or natural fruit juices,
aswellasfooddyefromcarpetandupholstery.RemovesMagicMarker,
cosmeticsandotherfoodspots.Separatesthefoodcoloringfromthe
stainedfiber.
When to Use: Excellentwhenremovingcommonhouseholdbeverages
orotherproductspillswhichcontainaciddyes,suchasredandpurplecolored
fruitdrinks,orangepopsiclesandsoda.
Why to Use: To safely and effectively remove dye stains from fiber
surfaceswithoutaffectingfabricdyes.
Coffee Break
General Description:CoffeeBreakisformulatedtoquicklyandeasily
removeneworoldcoffeeandtanninstains.
When to Use: Whenattemptingtoremovestubborncoffeeandtanninspots
oncarpetorupholstery.
Why to Use: To easily remove tannin discoloration caused by common
drinks,suchascoffeethathasnotbeenremovedbycleaningoruseofother
spotremovers.
Spot Remover
General Description:Ageneralspotremoverwhichisusedtoattacktar,
gumandmostfoodspots.Usestraightfromthebottle
When to Use: Canbeusedforaccidentalcleanupsothatspotdoesnot
become a permanent stain Spot Remover can also be used prior to
cleaningtohelpmoistenandloosenspotspriortotheirremoval.
Why to Use: Helpfulinpre-treatingspotspriortocleaningfortheir
completeremoval,sothatwickingwillnotoccurandspotsreturn.Fourounce
bottleisdesignedasaleave-behindpremium.Personalizedbottleswithlaser
printablelabelsprovided.
12
Physical Data: Dilution GITGOisusedfullstrength
Ratio:
pHFactors:9.0
Packaging: StockNo.Description
C1715 Carton,32oz.container
Physical Data: Dilution DYE-OUTisusedfullstrength
Ratio:
pHFactors:10
Packaging: StockNo.Description
11623
Carton,32oz.container
Physical Data: Dilution Tworoundedtablespoonsto
Ratio:
16oz.ofwater
pHFactors:9.5-10(indilutesolution)
Packaging: StockNo.Description
C1719 Carton,2lb.powderconc.,
triggersprayerandmeasurecup
Physical Data: Dilution SpotRemoverisusedfull
Ratio:
strength.
pHFactors:7.75
Packaging: StockNo.Description
PR124 Carton,1qt.container
C55012x1qt.containers
C560Carton,12x4oz.bottles
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Sodium Bisulfite
General Description: Apowderconcentrateusedforthecorrectionof
existingbrowningconditionssometimesfoundaftercleaningwhiteorpastel
coloredcarpetswhereoverwettinghasoccurred.
When to Use:UseSodiumBisulfitemixedwithalowpHDetergentsolution
indealingwithwater-stainedfabricorfiberortohelpbrightenwhites.
Why to Use: Willeliminatethebrownringscausedbyoverwettingof
fabricorfiber.Thisproductisexcellentathighlightingwhiteorlightcolors
andcanbeusedasanadditiveinsolutiontohighlightlightercolors.
Prism Odorless Acetic Acid
General Description: Anodorless,saferequivalenttoAceticAcidandother
commonacids.Aclearliquidthatwillnotfreezeundernormalconditions.
When to Use:AsapretreatmentspraypriortoapplyingUn-Duz-ItPetOdor
DecontaminantandStainRemover.
Why to Use: Helps to lower pH and aids in the effective treatment of
petodorandstainproblems.
Chemical Sponges
General Description: DryCleaningSpongesarechemicallytreatedsponges
usedtoremovesootandsmokeresiduefromalmostallsurfaceswithinthe
indoorenvironment.Usedbywipinginadownwarddirectionandareused
dry.Canbeusedandreused,justwashthemout.Maybemoredifficultto
usedeffectivelyinplasticorgreasefires,simplybecausethesootsticksto
surfaces.IttakessixtotwelveDryCleaningSpongestodoanaveragesizehouse.
When to Use:Safeandeffectiveforremovalofoilysoot,heavygrease
depositsonwalls,ceilings,etc.
Do-It-Yourself Carpet Spot Remover Kit
General Description: Acompact,completeandinexpensivecarpetspot
removalkitthatwilleasilyremovethemostcommonspotsandspills.
When to Use:Homeownercustomersandinstitutionalcleaningstaffwill
beabletotakecareofunsightlycarpetspotsthemselves.Savestimeand
money.Thickabsorbentminitowel.
Why to Use: Thishandylittlekitwithyourcompanystickerattachedwill
buildlotsofgoodwillandcustomerloyalty.It’sarealvalueforyou,and
yourcustomerswillappreciatehavingit.
Physical Data: Dilution 2tablespoonsto1gal.ofpreRatio: pared Low pH solution will
treatanybrowncondition.
Coversapprox.100sq.ft.
pHFactors:4.3(indilutesolution)
Packaging:
StockNo. Description
C1002
Carton,1-1/2lb.pkg.conc.
Physical Data: Dilution Usefullstrength
Ratio:
pHFactors:4
Packaging:
StockNo. Description
11169
Carton,1qt.container
Why to Use: Manysurfacesmaybenonwashable.Thesechemicalspongeswill
effectivelyremovesoilandsootcausedby
firedamage. Packaging:
StockNo. Description
F3249
ChemicalSponges-1dozen
Includes these products:
8oz.GeneralSpotRemover
8oz.GITGO
Handystep-by-stepspotremoval
instructioncard.
Packaging:
StockNo. Description
10016
BoxedKit
Accessories - Carpet & Upholstery Cleaning
Dispenser Spigot for 1 and 2-1/2 gallon containers
General Description: Replacesstandardscrew-oncapandhasconvenient
on/offhandlewithspout. When to Use:Attachthisconvenientandtimesavingspigottoanyliquid
Von Schraderproductyouhave.
Why to Use: Storeyourcontainersontheirsideandyou’llbeabletoquickly
refillmeasuringcupsandothercontainerswithoutliftingandpouringfrom
theopenedbottle.
Packaging:
StockNo. Description
C1640
DispenserSpigot
Dispenser Spigot for 15 gallon drum
General Description: Convenientsiphon-typehandpumpquicklyinserts Packaging:
throughthedrum’sfillerfitting
StockNo. Description
When to Use:Noneedtoliftheavydrumstobeabletopouroutdetergent. 10008
DispenserPump
Simplypullthepumphandleupanddowntodispensethesolutioninto
yourcontainer.
Why to Use: Savesyoutimeandmoney!Orderlargercontainerofdetergent
toreduceyourcostperconcentratedgallonofsolution.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
13
Wrench to open 15 gallon drum
General Description:Aspeciallysizedwrenchthatfits15gallondrum Packaging: fittings.
StockNo.Description
When to Use: After determining where you will store your 15 gallon 10009
Wrench
drums,usethewrenchtoopenthefittingtoinsertyourdispenserpump.
Why to Use: Allowsforsaferandfasteropeningofyourdrumcontainer.
Sprayer for Pre-Sprays and After Treatments
General Description: 1-1/2 gallon capacity compressed air sprayer is
constructed of lightweight polyethylene. Easy to transport and use with
heavydutyshoulderstrapandcarryhandle.Features:PVC39”hose;nylon
pumppiston;funnel-filltop;aluminumwand;brassnozzle;handlewiththumb
releaseandno-driptrigger.
When to Use: Idealforapplicationcoveringalargearea.Forexample,
“Before,”“Un-Duz-It,”“OdorExploder,”aswellas“CarpetProtector.”
Why to Use: Theapplicationwillbefaster
andlessfatiguing.Also,thetankwillhold
largerquantityofsolutionsoyouhaveless
downtimerefilling. Packaging: StockNo.Description
C1130 1-1/2GallonSprayer
“Mini Sprayer”
General Description: Convenient, “take-anywhere,” quart-size sprayer Packaging: forapplicationofpre-spraysandaftertreatmentsforcarpetandupholstery. StockNo.Description
When to Use: Idealforsmallersprayapplications.
C1641 “MiniSprayer”
Why to Use: Theconvenientsizeallowsthepre-treatmentandafter
spraystobeapplieddirectly.Also,thepump-up,trigger-releasemakesits
uselessfatiguing.
Carpet Coasters
General Description:Economicalandpractical,these2”squaresconsist
ofstronganddurablepolyethylene.
When to Use: Aftercarpethasbeencleaned,thesearethenplacedunder
thefeetofthefurnishings.
Why to Use: It is possible for stain and/or rust marks to come off
the feet of the furnishings. Carpet Coasters will prevent this from
happeninguntilthecarpethasdried.
Packaging: StockNo.Description
PR124 Carton,CarpetCoasters
(1000lotsonly)
Touch Up Brush
General Description:Whitemoldedplastichandlewithatotallengthof Packaging: 9”by5”areawithlayered1-3/4”bristles.
StockNo.Description
When to Use: Idealforuseonbaseboards,stairwaysandcorners.
F3202 Touch-UpBrush
Why to Use: Thisbrushisapracticalaccessorytohavebecauseitwillget
intohard-to-reachareas.
Spot Brush
General Description:Featureswoodhandlethatis7”by1-1/2”withsoft Packaging: naturalbristlesina2-1/2”by1-1/4”area.
StockNo.Description
When to Use: Convenientfortampingspotremovalagentsmoreeffectively. D90A
SpotBrush
Why to Use: The natural bristles are gentle enough to be used with the
delicatebrushingtreatments.
Nap Brush
General Description:Hasawoodenhandle9”long,abrushareathatis Packaging: 6”by1-1/4”filledwithnaturalsoftbristles.
StockNo.Description
When to Use: Useduringthedryingprocesswhilecleaningvelvetupholstery. D91B
NapBrush
Why to Use: Becauseofvelvet’sdelicatequality,thenapneedstobegreatly
liftedasitisdrying.Thisbrushisdesignedwiththatpurposeinmind.
14
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Velvet Brush/Groomer
General Description:Flexiblenylon-bristledhandtool.
Packaging: When to Use: Whengroomingpiledfabricssuchasvelvetandvelourafter StockNo. Description
cleaningorapplicationoffabricprotector.Alsoforgroomingstairwaycarpet. U1910 VelvetBrush/Groomer
Why to Use: Forevenandthoroughgroomingoffabricandproper
spreadingoffabricprotector.
Graduated Quart Measure
General Description: This is a quart (32 oz.) capacity plastic measuring
container.Measurementsareinounces,millilitersandcups,andaremolded
intotheoutsideofthecontainer.Theconvenientpourspoutmakesiteasyto
usewithoutspillingandwithminimumcleanup.
When to Use:Mostofthepre-spraysandaftertreatmentsneedtobediluted.
Thisgraduatedmeasurewilltaketheguessworkoutofaccuratedilution
ratiostomaximizetheuseofyoursupplies.
Tote Bag
General Description: Anidealtoteforaccessoriesneededwiththecarpet,
upholsteryandwallcleaningequipment.Itismadeofpliable,durablenylon.
Itsexpandablemeasurementsare23”by13”by9.”Collapsiblehandleand
wheelsforeasytransport.
When to Use:Anefficientandprofessionalapproachtoorganizingyour
cleaningequipmentandsupplies.
Why to Use: Becauseitismadeofplastic,
itismoreportableforon-the-sightmixing
of the solutions.Also, the measuring in
ounces,cupsandmilliliterswillallowyou
todothemixinginanyquantity.
Packaging:
StockNo. Description
D92D
GraduatedQuartMeasure
Why to Use: Thetoteisveryversatilein
thatitisdesignedtobeusedforallofyour
organizationandtransportationneeds.
Packaging:
StockNo. Description
U1901
ToteBag
High Density Foam Furniture Support Blocks
General Description: Snap-offstyle,1”x2”x2”whitestyrofoamblocks Packaging:
tokeepfurnishingsoffthecarpetwhiledrying.
StockNo. Description
When to Use:Highdensitystyrofoamwillsupportheavyfurnituresuchas C1655
Carton,1008Blocks
chinacabinetsandothersolidbasefurnishings.
Why to Use: Oneortwoblocksateachcornerofthefurniturewillallow
forairflowunderneath.Thiswillthenspeedupthedryingprocess.
Urine Detector Black Light
General Description: Asmallandcompactbatteryoperatedlightwitha
specialultravioletbulb.
When to Use:Toidentifythepresenceandlocationofurinespottedareason
thecarpet.Urineareas“glow”whenblacklightisshowninadarkenedroom.
Why to Use: Toquicklyandeasilydetectwhereurinespot/odorremoval
isnecessary.
“Econo” Disk Furniture Gliders
General Description: Fourdiskgliderswithanonskidcushionedsurface
ononesideandasmootheasy-slidingsurfaceontheother.
When to Use:Toeasilymoveanysizeorshapepieceoffurniturewhen
cleaningcarpet.Onlyonepersonneededtomoveevenheavyfurniture.
Why to Use:Savestime-noneedtoremovedrawersoremptyfurniture
priortomoving.Eliminatesbackstrain-noneedtoliftorcarryheavyfurniture.
Packaging:
StockNo. Description
10012
UrineDetectorBlackLight
10013BlackLightReplacement
Bulb
Simplytiltfurnitureandplaceaglider
undereachcorner.Thefurniturecanthenbe
movedeffortlessly.
Packaging:
StockNo. Description
F1590
Pkg.of4“Econo”Disk
FurnitureGliders
Waterproof Mat
Packaging:
General Description: Thisisastrong,wovenplasticmatthatis4’x4.’
StockNo. Description
When to Use:Thisisapracticalupholsterycleaningaccessory.
WaterproofMat
Why to Use:Thesematsarelargeenoughforyoutosetthefurnitureon, D110C
makinganideal“workplace”foryoutocleantheupholsterywithoutmoving
itoutoftheroom.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
15
Optional Stiff Brush for Carpet Systems
General Description:Thisbrushis13incheslong,withblackbristlesthat
arethicker,thereforemoreaggressive,thanthestandardwhiteVonSchrader
carpetmachinebrush.
When to Use: Thestiffbrushisidealforlowprofilecarpetmostcommonly
foundincommercialsettings.
Why to Use: Inacommercialsetting,thecarpetisnormallyseverelysoiled
withoilydepositsandembeddedsoil.Becausethisbrushismoreaggressive
thanthestandardwhitebrush,itwillbemoreeffective.
Optional Stiff Brush for Upholstery System
General Description:Twobrushesarerequiredforoperationofthismachine.
Bothsmallinnerbrushandlargeouterbrushhaveblack,moreaggressive
bristlesthanthestandardbrushesoriginallyincludedwiththeSystem.
When to Use: Idealforuseoncarpetedstairways,orwhereverindoor-outdoor
carpetingisused(boats,forexamples).
Why to Use: Thestandardbristledbrushesaregentlyeffectiveforupholstery
fabrics.Whendoingcarpetedstairsandsuch,amoreaggressiveagitationis
needed.
Carpet Pile Grooming Brush
General Description:Twotypesofgroomingheadsattachedtoonehandle
forthebestincombinationcleaning.Onesidehasasinglerowofnylon
fibersspeciallydesignedforapplicationstoorientalrugs,Persians,velvets,
aswellascommercialstylessuchasBerbers.Theothersideisperfectfor
thefinishingsteptoenhancemulti-levelcarpetpileappearance.
When to Use: Idealforconditioningcarpettexturesanddeodorizing
treatments.
Carpet Repair Kit by Orcon
General Description:Carpetdamageupto3”indiametercanbefixed
instantaneouslywiththisCarpetRepairKit.Therepairisaseasyasinserting
anadhesivepadandputtingdownamatchingpatchfromahiddenareaor
remnantintothesameposition.
When to Use: Makerepairstoburnsandnon-removablestains.
Why to Use: Itiseasyandsafetouseasitinvolvesjustfoursimplestepsto
removethedamagedareacleanly,quicklyandwithprecision.
Packaging: StockNo.Description
F1025D OptionalStiffBrushforall
CarpetExtractionSystems
F1000DStandardWhiteBrush
Packaging: StockNo.Description
U1780A OptionalBlackSmallStiff
Brush
U1785BOptionalBlackLargeStiff
Brush
U1750AStandardSmallWhiteBrush
U1775BStandardLargeWhiteBrush
Why to Use: Thisbrushistheperfectgrooming
toolforgettingcarpetprotectordownintothe
fiberafterthecarpethasbeencleanedwith
theCarpetExtractor.
Packaging: StockNo.Description
F3252 CarpetPileGroomingBrush
Packaging: StockNo.Description
F3237 CarpetRepairKit
F3261ReplacementBlades
F3262ReplacementPads
Cleaning Pan
General Description:Aplastictraydesignedspecificallyforrinsingyour Packaging: CarpetExtractor.
StockNo.Description
When to Use: Itshouldbeusedaftereveryday’suseofyourCarpetExtractor. F3000E CleaningPan
Why to Use: Becauseofitssize,itstoresnicelyandwillaccommodate
yourExtractor,makingitconvenienttomaintainefficientlyandwithminimum
clean-upafterword.
Gauge Stick
General Description: This wooden accessory is 16” long with markers Packaging: atthe2quart,4quart,6quartand8quartmark.
StockNo.Description
When to Use: WithGaugeStick,youareabletokeeptrackoftheamount U1907 GaugeStick
ofdetergentsolutionyouhaveleftinyourdetergenttank.
16
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Funnel
General Description: Thisfunnelismadeofwhiteplastic,withablack Packaging:
StockNo. Description
rubberhose.
FunnelwithTube
When to Use:Withthisfunnelyoucanpourdetergentsolutionintothedeter- U1925
genttankmoreefficiently.
Why to Use:Byusingthefunnelyoucaneliminatethemessandwaste
thatresults.
Motor Scrubber Plus
General Description: The“ULTIMATECLEANINGSYSTEM”justgot Packaging:
better!ThenewMS1505NE“MotorScrubberPLUS”offersallthescrub- StockNo. Description
bingpowerandversatilityofthestandardMotorScrubber…PLUS,a
MS1
MotorScrubberPlus
powercleaningsolutiondispenser!TheMotorScrubberPLUSstarterkit
includesthescrubberheadandhandle,dispenserand20oz.solutiontank,
backpack&battery,5ft.coilcord,aggressive-dutybrush,batterycharger,
completeoperatinginstructionsand12monthwarrantycard.
When to Use:Foredging,stairsorotherhardtoreachareas.
Accessories - VS 3 Power Wall Cleaning System
Wall Cleaning Pads for VersaTile and VS 3 Gliders
General Description: Made ofheavy specially wovencottontoretain
moistureandpickupdirt.
When to Use:FitsneatlyontothenewVersaTileandVS3DetergentGlider
andBuffingGliderwithVelcro,forcleaningwallsofalltypes:painted,marble,
washablewallpaper,etc.
Why to Use:Thematerialmakingupthesewallcleaningpadsishighly
absorbentterryclothsotheycanbeusedwithoutfrequentchangingandboth
sidescanbeusedtomaximizeeachcleaningpad.Also,thelongevityis
betterbecausetheystanduptonumerouswashingtreatmentsbeforethey
needtoberetired.
Brush Glider for VersaTile and VS 3
General Description: Heavydutynylonbristlebrushattacheseasilytonew
VersaTileandVS3DetergentGliders.Detergentsquirtsthroughthebristles
andontothesurface.
When to Use:Idealforcleaningheavilytexturedwallsurfacessuchasstucco,
Spanishplaster,paintedcement,etc.Youcanexpandyourbusinessintofire
damagerestorationasthisattachmentwillallowyoutocleanfiresmokewalls.
Why to Use:Thebristlesonthebrushreachintodeepcrevicestoemulsify
anddislodgesoil.Youcancleanlargesurfaceswithoutmovingtheentireunit
eachtimeyoucleanasection.
Packaging:
StockNo. Description
W375
HeavyDutyforSerial#4034
andlower,1dozen,4fold
W848withVelcroforSerial#4035
andhigher,1dozensinglefold
Packaging:
StockNo. Description
W845
BrushGliderforSerial#4035
andhigher
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
17
Detergent Glider for VS 3 Power Wall Cleaning System
General Description: The Glider comes complete with a 25 foot hose, Packaging: andpush-buttoncontrol.IthasVelcrostripsforfasttowelpadattachment. StockNo.Description
When to Use: Thisisthefirststepinthewallcleaningprocess.Goodfor W846
DetergentGlider
smoothsurfacessuchasplaster,washablewallpaper,paintedsurfaces,etc.
Allowsforevenapplication.
Why to Use: Thislightweightgliderwillassurethereisaminimumamount
ofpressurerequired,makingtheprocesslessfatiguingthanifcleaningbyhand.
Also,thegliderisnon-marring,abenefitthatallofyourcustomerswill
appreciate.
Buffing Glider for VS 3 Power Wall Cleaning System
General Description:BuffingGlidercomescompletewithVelcrostrips Packaging: forfasttowelpadattachment.
StockNo.Description
When to Use: Effectivelycleansthewallwithminimumeffort.
W847
BuffingGlider
Why to Use: Thisprocedureisfourtimesfasterthandoingitbyhand.
Further,thesurfaceiscleanedwithoutdrippingorstreaking.Thisisa
benefitinthatthecustomerwillappreciatekeepingclean-uptoaminimum.
High Reach Pole Packages for VS 3 Wall Cleaning System
General Description:Extendedlengthapplicationanddryingpoleswithglidersallowyoutoclean
highwallsandceilingsfasterandeasier.
When to Use: Eliminatesbringingaladdertothejob,allowsyoutocleanwallsandceilingssafelyfrom
thefloor.
Why to Use: Reduceslabortimeandcleaningcosts.Nocostlyscaffoldingtorentandsetup.Standard
Pole Package for surfaces up to 12 feet high. Maxi-Reach Pole Package for cleaning hard-to-reach
surfacesupto18feehigh.
Packaging: StockNo.Description
W852StandardHighReachPackage
W853Maxi-ReachPackage
Accessories - VersaTile Acoustical Tile Cleaning
(Also refer to VS-3 Accessory Section page 17) Sponges for VersaTile
General Description:Thesespongeswillenableyoutowipeonlythegridworksupportingtheceilingtilethattheyareexclusivelydesignedtokeep
contactfromthetilesurface.
When to Use: Thesespongeswillallowyoutocleanallnon-poroussurfaces
suchasgrids,vents,diffusers,exposedlightlenses,etc.Thestandardandthin
spongesareavailableforvaryinggridwidths.Thelargespongeisforlarger
cleaningjobssuchasspeakercovers,vents,andexposedlightfixtures.
Why to Use: Theexclusivedesignofeachspongeallowswipingthesurface
quickly,effectively,andwithlessfatigue.
Drop Cloth
General Description: Ideal for protecting moisture sensitive surfaces,
suchasfurniture,carpeting,paperwork,desktops,etc.
When to Use: Theyareeconomicalenoughtouseforeverycleaningjobandare
recommendedforusewheneverpotentialdripsmayfallontofloorsandfurniture.
Why to Use: Thepaperwillabsorbmoisturefromsoakingthroughtothe
protectedsurfacemakingthisdropclothreusableanumberoftimesbefore
retiringit.
18
Packaging: StockNo.Description
H1124StandardSponge
(forgridwiping)
H1125ThickSponge
(forgridwiping)
H1126ThinSponge
(forgridwiping)
Packaging: StockNo.Description
H11809’x12’DropCloth
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Restorer
General Description: Specially formulated sprays for spots and marks Packaging:
thatcannotberemovedwithnormalcleaningprocesses.
StockNo. Description
When to Use: Theremaybesomewatermarkingthatcannotbecleaned. H1181 Restorer-White
Watermarkingisnotdirt,itisdamage;therefor,ratherthanreplacingcostly
acousticaltile,thesesprayswillrestorethetilebacktoitsformercolor.
Why to Use: Thesespraysareeconomicalaswellaswashable,sothetile
canbecleanedinthefuture.Thespraysareavailableintwocolors:White
andEggshelltomatchmostceilingcolors.
Goggles
General Description: Clearplasticeyeprotectionforusewhenevercleaning
productscouldcomeincontactwitheyesduringthecleaningprocess.
When to Use: Tobeusedanytimetheremaybechemicalsprayinvolved.
Thisisasafetyprecautionthatshouldbetakeninareasofcleaningand
restoration.
Why to Use: Withanyrestorationprojecttheremaybeachemicalspray
orsplashthatcannotbeanticipated.Thesegoggleswilladequatelyprepare
youforanysuchsituation.
Respirator
General Description: Asasafetyprecautionthatshouldbetakeninall
areasofcleaningandrestoration,thisRespiratorwillfilteroutthetoxins
andallowyoutobreathfreely.
When to Use: Meantforuseanytimeyouareworkingonacleaningrestorationprojectwheremistingchemicalswillbeinvolved.
Why to Use: ThisRespiratorisdisposable,makingiteasytouse.
Rubber Gloves
General Description: DisposableRubberGlovesdesignedwithyourprotectioninmind.Thisisconsideredanaddedprecautionthatshouldbetaken
atanyfacetofacleaningrestorationproject.
When to Use: Thesearesuggestedtobeusedwithanychemicalsand
solventsthatyouwillbeworkingwith.
Why to Use: Anotherbenefitisthattheseareidealforanyunknownallergies
thatyoumayhave.
Drip Sponge
General Description: 8”x2-1/2”absorbentspongeforVersaTileSpray
PoleorVS-3Maxi-ReachPolePackage.
When to Use: Wheneversprayingacousticaltilecleaningsolutionor
wall/ceilingcleaningsolutionoverhead.
Why to Use: Tocatchmuchofthefallingmistanddripsfromoverhead
spraying,reducingmoistureonflooringsurfacesanddropcloths.
Packaging:
StockNo. Description
H1183 Goggles
Packaging:
StockNo. Description
H1184
Respirator-DisposableMist
Protection
Packaging:
StockNo. Description
H1185
RubberGloves,1pair
Packaging:
StockNo. Description
H1177
DripSpongeforVersatileor
VS-3Maxi-ReachPole
Package
VersaTile Demonstration Kit
General Description: Sturdycarryingcaseholdspowderedacousticaltile Packaging:
cleaner, spray bottle, dirty ceiling pieces, demo videotape and handout StockNo. Description
10007
VersaTileDemonstrationKit
promotionalflyers.
When to Use: HandyKithelpsconvincebusinessownerstohavetheir
acousticaltileceilingscleanedbyshowingcleaningresults.
Why to Use: Ifyou’reunabletobringtheentireVersaTileSystemtodoa
ceilingcleaningdemonstration,orthemanageronlyhaslimitedtime,the
DemoKitistheanswer.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
19
General Advertising and Printed Material
“Von Schrader” 3 Ring Binder (stores material for easy access)
General Description:Idealforprotectingandpresentingmarketingandsales Packaging: promotionmaterials,and“beforeandafter”picturesofyourfavorite StockNo.Description
successfulcleaningsituations.
Form20963RingBinder
When to Use: Anytimeyou’rerequiredtoprovideapresentationofyour
servicesforbiddingorestimatingservice.
Why to Use: You’reaprofessional.Makesforausefulpresentation,
storage,andveryhandymarketingtool.
Thank You Cards
General Description: On gray tri-fold paper, with burgundy ink, this
mementoisawonderfulwaytoensureyourcustomerswillrememberyou.The
messageisathankyouforallowingyoutodobusinesswithyourcustomer.
Anotherwonderfulfeature:theyhaveaslotforyoutoinsertyourbusinesscard.
When to Use: Thesecardscanbeleftattheendofyouron-locationcleaning
restorationproject.Generallygearedtowardtheresidentialcustomer.
Why to Use: Asureimageenhancerbecauseyourclientwillrememberyour
specialtouch.TheVonSchradercolorsareused,addingaprofessionaltouch.
Packaging: StockNo.Description
Form1058ThankYou Cards
Quantity:100/500/1000
Sales Presentation Binder (Carpet, Upholstery, Wall and Acoustical Ceiling Tile Cleaning)
Sell easier, sell better, completely indexed, 3/4” polypropylene 3 ring binder
General Description:Thesalesmaterialwillaccommodatethecomplete
Von Schraderequipmentline.Thiscompletelyindexedbinderwilladdto
yourtotalsale.
When to Use: The advice and suggestions included will help you to
buildyourbusinessintoaprofitableone.
Why to Use: Theendorsementlettersalonewillhelpyoutoproveyour
credibility to your potential client. In no time at all you’ll be able to
replace those endorsement letters with
letters of your own giving praise to the
qualityofworkyoudo.
Packaging: StockNo.Description
Form2060SalesPresentationBinder
“Von Schrader” Presentation Folder
General Description:Attractivelightgrayandbluefolderwithinsidepocket
foryourinformationsheetsandaplacetoholdyourbusinesscard.
When to Use: Wheneveryouhaveanumberofinformativepiecesorajob
quotationtogiveanimportantpotentialcommercialcustomer,thisfolder
canbeused.
Why to Use: Impartsaninstantprofessionalimagetoyourbusinessinthe
eyeofyourprospectivecustomer.Withyourcompanystickerorbusiness
cardattacheditwillkeepalloftheinformationtogetherandmakealastingimpression.
Packaging: StockNo.Description
Form2150PresentatinFolder
Quantity:10
Magnetic Vehicle Identification Panel
General Description: Rubber magnetic signs, 10” x 16”, with the Von
SchraderlogoinVon Schradercolorswillannounceyourservicestothe
community.Theblankspacebelowwillallowyoutointroducethename
of your company and telephone number (use dye cut letters available at
anyhardwarestore).
When to Use: Thesemagneticpanelsareexcellentadvertisementonthe
doorsandbackofyourvehicle.
Why to Use: Thepriceofthesepanelsmakeitanattractivealternativeto
havingyourvehiclepainted.Intheeventyourvehicleforyourbusinessis
alsothevehicleyouhaveforprivateuse,you’llbeabletoalternatebetween
thetwopurposes.Inaddition,softrubber
backingattachedtoacleansurfacewillnot
harmthepaintinanyway.
Packaging: StockNo.Description
F3259MagneticVehicle
IdentificationPanel
Von Schrader Systems DVD Demonstration
Why to Use: The quality of this DVD
maintainstheprofessionalthreadwhich
General Description:Atwo-and-a-halfminutesegmentdesignedincom- VonSchradercontinuestoweavethroughmercialformthatpresentstheCarpetandUpholsterymachines.Another outtheircompany.
segmentisavailabletodemonstratetheVersaTileAcousticalTileCleaner.
TheseDVDshavemanyuses.
Packaging: When to Use: This DVD is ideal to view with a potential customer if StockNo.Description
theydon’thavetimeforanactualequipmentdemonstration.Inaddition, Form2669DemonstrationDVDof
theDVDcanbeusedattradeshows,homeshows,exposhows,evenasa Esprit,LMX,VersaTile,and
televisioncommercial.
Mach-12
20
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Vehicle Business Card Pocket Display Kit
General Description: Placeyourbusinesscardsinthisplasticpocketthat
affixestothesideofyourbusinessvehicle.Prospectivecustomerscantake
oneofyourbusinesscardsevenwhenyou’renotaround.Thebusinesscard
holdereasilyslidesoffamountingbracketsoyoucanbringitintoyour
homeorofficewhennotinuse.
Packaging:
StockNo. Description
10060
VehicleBusinessCard
PocketDisplayKit
Multi-Service Door Hanger: Carpet, Upholstery, Wall Cleaning
General Description: Thisparticulardoorhangerpresentscarpet,upholstery
andwallcleaningtoyourprospectivecustomersinaneyecatchingyellow.
When to Use:It’sawonderfulintroductoryitemtoplaceonthedoorsof
homesinyourcommunity’sneighborhoods.You’llbeabletotargetalarge
numberofresidentswithlittletimeinvested.
Why to Use:Thismethodallowsyoutointroduceyourselftoacommunityefficiently,quickly,andatalowcosttoyou(aslittleas8centsperhanger)
andbyusingthespaceonthebacksidefor
ourcompanycontactinformation.
Packaging:
StockNo. Description
Form2270MultiServiceDoorHanger
Multi-Service Circular: Carpet & Upholstery Cleaning
General Description: Introducescarpetandupholsterycleaningusingthe
AirCellExtractionmethodtoyourprospectiveclients.
When to Use:Thiscolorfultri-foldbrochurecanbeincludedindirect
mailingsorleftatthedoor.
Why to Use:Withthespacereservedonthebacktoannounceyourcompany
nameandcontactinformation,youcanintroduceyourserviceseffectively.
Packaging:
StockNo. Description
Form2393Multi-ServiceCircular
Quantity:100/500/1000
Associate Sales Quote Brochure: Carpet & Upholstery Cleaning
General Description: Colortri-foldbrochureprovidespersonalizationfor
carpetandupholsterycleaningservices.
When to Use:Handoutforeachjobyouquote.
Why to Use:Easyforaprospectivecustomertocontactyoutoconfirman
appointmentforyourservices.
Guide to Spot and Stain Removal Brochure
General Description: Thisbookletwillprovideaquickandeasyreference
forhandlingvirtuallyanyspotorstain.Itworksinconjunctionwiththe
ProfessionalSpotRemovalKit.
When to Use: Keepitinyourspotremovalkitatalltimestohelpidentify
spotsanddeterminewhichspotremovalproducttouse.
Why to Use: Savestimewhileyou’reonthejob.Eliminatesguesswork
byadvisingyouwhichproductstouseandtheirsequence.
Packaging:
StockNo. Description
Form2693Multi-ServiceQuoteCircular
Quantity:50
Packaging:
StockNo. Description
Form2061EGuidetoSpotandStain
Removal
Reminder Post Cards General Description: Whitepostcardimprintedonthefrontwitharedstringtiedaroundthefinger.
Onthebackthereisanareawithroomforyourcompanynameandphonenumbertobeprinted.
When to Use: Theseareconvenienttosendtocustomerswhenitistimeto
Packaging: havetheircarpet,furnishings,etc.,cleaned.
StockNo. Description
Why to Use: Withareminderpictureonthefrontandapostcardbackside,you Form2413ReminderPostCards
canprintvirtuallyanymessagetokeepcommunicationopentoyourcustomerbase.Qty100
How’s Your I . A . Q . Pamphlet General Description: Informative,explainstheindoorairquality(I.A.Q.)issue,andhowitrelatesto
carpet,upholstery,wallandceilingcleaninginthelivingandworkingenvironment. When to Use: Primarilyforusewithpotentialcommercialcustomers.Also
explainstheE.P.A.’srecommendedcarpetcleaningfrequency.
Packaging: Why to Use: Willhelpyoupromotethehealthbenefitsformorefrequent
StockNo. Description
cleaningofinteriorsurfaces.Usetoimpressyourcustomersandgiveyouan
Form2451 How’sYourI.A.Q.
“edge”overyourcompetition.
Brochure.Qty.50
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
21
Un -Duz- It Brochure for “Pet Odor Removal” General Description: ExplainshowUn-Duz-Itsolvesthechallengesofanimalrelatedodors.
When to Use: Anidealleave-behindwhenyou’recleaningcarpetorupholstery Packaging: inhomeswhereapetisliving.Alsocanbeusedtopromotethisspecialodor
StockNo. Description
controlservice.
Form2568Un-Duz-ItBrochure
Why to Use: Educatesthecustomer.Helpsbuildextraadd-onbusinessforyou. Qty.50
Microban X -590 Sheet General Description: Attention-gettingbrochureexplains“Ittakesmorethancleaningtostopgerms,insects,odors.”
When to Use: Asanenvelopeinsertorhandoutpiecetohelpdescribethis
Packaging: environmentalprotectionservicethatyoucanoffer.
StockNo. Description
Why to Use: Helpstobroadenyourvalueandservicestoyourcustomers,by
Form2567MicrobanX-590
enlighteningthemtothehealthdangersthatexist,andthetreatmentyoucanoffer. Sheet.Qty.50
Residue Card General Description: SalesaideexplainingresiduecharacteristicsofVon SchraderDetergents.Cardmeasures7”x10”.Laminated.
When to Use:Duringanysalespresentation/discussionoftheVon Schrader
CleaningSystem.
Why to Use: Instillsconfidenceinyourcustomertomakethecorrectchoice
ofcleaningsystems.
Packaging: StockNo. Description
Form2532ResidueCard
Von Schrader Cap General Description: Khakicapadjustabletoanysize.
When to Use: Wearforbusinessorforpleasure.Packaging:
Why to Use: Givesyouandyouremployeesthatcompleteprofessional,StockNo.Description
neatlook.HarmonizeswithyourVon Schradersportshirt/uniform.
843KNAKhakiCap
Patches General Description: Colorfulandeye-catching,
thesepatchesaremachine-stitchedtobesewn
ontoyouruniform. When to Use: Sewontoyouruniformshirts,
jackets,etc.
Why to Use: Thesepatcheswillhelptoadvertise
yourstatusinthecleaningindustrytoclientsand
prospectivecustomers,aswell.
Packaging: StockNo.
Description
870VS1
AuthorizedAssociatePatch
Available to Certified Technicians: QualifiedAssociatePatch
ProfessionalCleanersSchoolGraduatePatch
StainResistCertificationPatch
AdvancedCleaningSchoolGraduatePatch
NationalAcademyofVon SchraderAssociatesPatch
Operating Instruction Manuals, Videos and DVD Disks
General Description: Alsoreferredtoasan“OwnersManual”,thesebooks
willhelpyouwithassembly,generalmaintenance,trouble-shooting,and
cleaningchallenges.Alsoincludesaschematicofthemachine’sassemblies.
Packaging: StockNo. Description
F2822F
F2836
F2840
F2840H
F2840L
U2020
U2023
U2028
U2004B
W628
W646
W647
Form27B
H1152
Form2669
22
Instructional Videos/Training Films
for Older Model Machines
General Description: FilmedonhighqualityVHSfilm
thisvideoenhancestheinformationprovidedinthe
InstructionManual.
Packaging:
StockNo. Description
VS-1OperatingInstructionManualBelt-driven
VS-1OperatingInstructionManualChain-driven-Tan
VS-1OperatingInstructionManualChain-driven-Grey
F3263A VS-1CarpetExtractorTrainingVideo
LMXOperatingInstructionManual
F3263BLMXCarpetExtractorTrainingVideo
LMXwithDefoamerTankOperatingInstructionManual
F3263CLMXwithDefoamerTankTrainingVideo
VS-2OperatingInstructionManual-Tan
K3519VS-12CarpetExtractorTrainingVideo
VS-2OperatingInstructionManual-Grey
U2024VS-2UpholsteryExtractorTrainingVideo
U2024AEspritUpholsteryExtractorTrainingVideo
EspritOperatingInstructionManual
H1190VersaTileInstructionVideo
VS-2OperatingInstructionManual-Black
Form2669CarpetLMX,UpholsteryEsprit,Wall&
VS-3OperatingInstructionManual-Electric,TanorBlack
CeilingVersaTileDVDOperatingInstructions
VS-3OperatingInstructionManual-Electric,Grey
VS-3OperatingInstructionManual-startingwithSerial#WB4034&higher
VS-3OperatingInstructionManual(manualpump)
VersaTileOperatingInstructionManual
Disk-LMX,Mach12,Versatile,Esprit,InstructionandDemonstrationDVD.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Carpet Extraction System™ Marketing Supports
Full Color “Facts” Advertising Circulars General Description: ThisisVonSchrader’smostpopularcircularasitpointsoutthebenefitsoftheVonSchrader
ExtractionSystemindetail,whilecontrastingittoothermethodsonthemarkettoday.Thereisaspaceonthe
backsideforyoutoincludeyourcompanynameandphonenumber.
When to Use: Thisisawonderfulideawhendealingwithprospectivecustomersbecauseitincludesin
itscomparisontherotarymethod,the”steam”method,andthebonnetmethod.Morethanlikely,
theyhaveusedoneofthesemethods,orknowsomeonewhohas.
Why to Use: Whenthinkingabouthavingcarpetscleaned,peopleusuallywill
Packaging: asktheirfriendsandfamilywhichcompanytheyshouldcontact.Bypresenting StockNo. Description
thisbrochuretothatprospectivecustomer,youwillbeabletoeducatethemtothe Form1060 “Facts”Circulars
prosoftheLowMoistureExtractionmethodandtheconsofthealternativemethods.
Qty.100
Full Color Carpet Cleaning Counter Display Cards General Description: Youwillreceiveasetof3colorful11”x14”easeldisplaycardswithadvertising
circularpockets.Thesecircularpocketswillholdyourfavoritecirculartodistributetopotentialcustomers.
Ithasastandattachedtothebacksothatitwillsitonanyflatsurfaces.
Packaging: When to Use: Idealfordisplayinretailoutlets,homeshows,exposhows,
StockNo. Description
andtradeshows.
Form1026 FullColorCarpet
Why to Use: Displayingthesecounterdisplaycardsincommercial
CleaningCounter
establishmentswillhelptogenerateinterestinyourcleaningservices.
DisplayCards(3)
Carpet Cleaning Door Hangers General Description: Thisdoorhangerisdesignedtoinformyourpotentialcustomersofthe“BaitandSwitch”
tacticsusedbyothercarpetcleaners.Blackprintonawhitebackgroundwithredhighlighting,andaspace
onthebacksideforyourcompanynameandphonenumber.
When to Use: Thisdoorhangerisconvenientforleavingonthedoors
Packaging: intheneighborhoodafteryou’vecleanedyoucustomerscarpet.
StockNo. Description
Why to Use: Thehardestthingtoovercomeisthepriceobjection.This
Form2273 CarpetCleaningDoor
doorhangerallowsyoutoputtheballinyourcourtbyexplainingtoyour
Hanger
prospectiveclienthowyourcompetitorcanoffersuchlow,lowprices.
Qty.100
“Pssst!” Carpet Cleaning Door Hanger General Description: Thisisourmostpopulardoorhanger.Blackprintonawhitebackgroundwithred
highlighting.Itisawonderfulitemtogainalargercustomerbasebylettingthemknowyoujustcleanedtheir
neighbor’shomewiththeVonSchraderLowMoistureSoilExtractionCleaningSystem.
When to Use: Aswithallofourdoorhangersthisisaconvenientwayto
gaincustomers.Simplygodoortodoorinyourcustomer’sneighborhood, Packaging: afteryou’vecleanedtheircarpet,andattachthisdoorhangertoeachdoor. StockNo. Description
Agreatwaytocommunicatetoyourpotentialcustomers.
Form2380 “Pssst!”CarpetCleaning
Why to Use: Aneye-catchingidea!Arousecuriosity,andinformyour
DoorHanger
potentialcustomerwhattheirneighborhasbeenupto.
Qty.100
Advanced Formula Carpet Protector Circular General Description: Thecircularcontainscolorfulsales-packedinformationabouttheaftertreatmentdesigned
toprotectcarpetfromdirtandgrimeandeasierspotremoval
When to Use: Thesecanbeincludedwitheachinvoice,receiptofsale,
Packaging: quotationandpresentation,evenasanexhibithandout.
StockNo. Description
Why to Use: Thiscolorfulcircularhelpskeepyourcustomerinformedof H93869
CarpetProtectorCircular
thisservicetoenhancethecarpetbetweencleanings.
Qty.100
Packaging:
“Carpet Appearance Protection Plan” Brochure StockNo.Description
General Description: Thiscircularcontainsinformationthatwillgiveyou Form2382CarpetAppearance
helpfulhintsonkeepingyourcarpetproperlymaintained.ProtectionPlanBrochure
Qty.50
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
23
Upholstery Extraction System™ Marketing Supports
Full Color Advertising Circulars General Description: Thisbrochurefullyhighlightsthemeritsofthe
VonSchraderLowMoistureUpholsteryCleaningSystem. When to Use: Mailoutorhandout.Thisbrochurewillassistyouin
securingclients.Professionallookingandyoucanpersonalizewith
yourcompanynameandtelephonenumber.
Why to Use: Theywillenhanceyourabilitytoexplain
andsellyouruniqueservice.
Packaging:
StockNo.
Form2129
Description
UpholsteryExtraction
System™FullColor
AdvertisingCirculars
Qty.100
Full Color Upholstery Cleaning Counter Display Cards General Description: Youwillreceiveasetof3colorful11”x14”easeldisplaycardswithadvertisingcircular
pockets.Thesecircularpocketswillholdyourfavoritecirculartodistributetopotentialcustomers.Ithasa
standattachedtothebacksothatitwillsitonanyflatsurfaces. Packaging: When to Use: Idealfordisplayinretailoutlets,homeshows,
StockNo. Description
exposhows,tradeshows.
Form2384 FullColorUpholstery
Why to Use: Displayingthesecounterdisplaycardsincommercial
ExtractionSystem™
establishmentswillhelptogenerateinterestinyourcleaningservices.
CounterCards(3)
Upholstery Protector Circulars General Description: Awonderfultwo-foldbrochurethatoffersavisualaidwhen
explainingtoyourcustomerhowFabricProtectorpreventsspillsfrombecomingstains.
When to Use: Perfectasavisualaidforyourpotentialcustomer.Itcould
Packaging: alsobedistributedathomeshows,tradeshows,etc.Itcouldbeincluded withinvoices,evaluationsorduringapresentation/demonstration.
StockNo.Description
Why to Use: Thiscircularisdesignedtopiquecustomercuriosityand
E64752UpholsteryProtector
interestinthisprofitableadd-onservice.
CircularQty.100
Upholstery Cleaning Door Hangers General Description: Thisdoorhangerintroducesprospectivecustomerstothe
advantageofcleaningtheirupholsteryusingtheVonSchraderLowMoistureSoil
ExtractionMethod.Blackprintonawhitebackgroundwithredhighlighting. Packaging: When to Use: Thisdoorhangerisdyecuttoholdbusinesscardsandhasa
StockNo.
spaceforincludingyourcompanyinformation.
Form2400
Why to Use: Whatbetterwaytocommunicateyourservicestothecommunity? Thisdoorhangerwillallowyoutoleaveareminderwiththemevenafteryou’regone.
Description
UpholsteryCleaning
DoorHanger
Qty.100
Upholstery Care Brochure
General Description:Inafolderformat,thishighlyinformativebrochureisentitled“SmartCareforUpholstery”.
When to use:Distributingthefoldersthroughdirectmail,exhibithandoutsandpersonalpresentationwill
remindpersonsinyourcommunitythatyouaretheexperttocontactwhen
furnishingsneedattention.
Packaging:
Why to use:Thisbrochureisdesignedtoencourageyourcustomersand
StockNo. Description
prospectstolooktoyouastheexpertinupholsterycleaningandtoconsult
Form2308 UpholsteryCare
youontheirfurniturecleaningproblems.
BrochureQty.50
Car Care Circular
General Description:Thiscircularintri-foldformat,promotesyourservices
incleaningautomobile,RV,marinecraftupholstery.
When to use:Canbedistributedtousedcardealers,atmarinasandtradeshows.Packaging:
Why to use:WithphotosshowingtheuseoftheLowMoistureUpholstery
StockNo. Description
Cleaningsysteminvariouscapacities,thisisagreatvisualaidforyour
Form2347 CarCareCircular
potentialcustomer.
Qty.100
Associate Sales Quote Brochure: Upholstery Cleaning
General Description:Colortri-foldbrochureprovidespersonalizationfor
cleaningvariousupholsteryinstallations.
When to use:Handoutforeachjobyouquote.
Why to use:Easyforaprospectivecustomertocontactyoutoconfirman
appointment foryourservices.
24
Packaging:
StockNo. Description
Form2701 UpholsteryQuoteCircular
Qty.50
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Multi Service Upholstery Care Brochure
General Description: Atri-foldfull-colorbrochureoffersfabricandleather
care,disinfectantandprotectioncleaningandapplication.
When to Use: Salesaidetosellservicesbeyondcleaningforboth
residentialandcommercialcustomers.
Packaging:
StockNo.
Form2506C
Description
MultiServiceUpholstery
CareBrochure
Qty.50
Power Wall Cleaning System™ Marketing Support
Full Color Advertising Circular
General Description: Thefull-color,bi-foldwallcleaningcircularillustratesthesystem’s
capabilityofbeingeffectiveandsafeforallwashablesurfaces.Thespaceonthebacksidewill
allowyoutoincludeyourcompanynameandphonenumber.
When to Use: Thiscircularcanbedistributedtoanyoneneedingthis
Packaging:
service.Includewithinvoices,distributeathomeshows,orinclude
StockNo. Description
duringapresentationorwithanevaluation.
Form2135 PowerWallCleaning
Why to Use: Thisbrochurecommunicatestoyourpotentialcustomerthat
System™FullColor
thePowerWallCleaningSystemwillcleanallwashablewallsurfaces.
AdvertisingCirculars
Forexample:woodpanelingandwashablewallpaperorpaint.
Qty.100
Wall Cleaning Square Footage Guide
General Description:Thisbrochureisdesignedtohelpyoutocalculate
thesquare footageinpreparingabidforacustomerorpotentialclient.
When to Use: Idealandpracticalasitistimesaving.Usethisfor
anynecessarysquarefootagecalculationsyouneed.
Packaging:
StockNo. Description
Form971
WallCleaningSquare
FootageGuide
VersaTile Wall & Acoustical Tile Cleaning Marketing Support
VersaTile Full Color Advertising Circulars
General Description: Atri-fold,full-colorbrochurewillintroduce
yourVersaTileservicetopotentialcustomers.
When to Use: Thisbrochurecanbeincludedwithevaluationsor
proposals,directmailingsandinvoices.Idealfordistributionat
homeshowsortradeshows.
Why to Use: Thecolorphotosandeasy-to-readmannerinwhich
theinformationispresentedisahelpfulintroductionofyourservices
toyourcustomer.
VersaTile Envelope Insert Circulars
General Description: Thisistheenvelope-sizeversionoftheVersaTile
ColorAdvertisingCircular.Itisaninformativewaytointroduceyour
VersaTileServicetopotentialcustomersandyourexistingcustomerbase.
When to Use: Becauseofitssize,youcanincludethiscircularwith
personalletters,directmailingsorinvoices,aswellasevaluationsorproposals.
Packaging:
StockNo. Description
H1188
VersaTileWall&Acoustical
TileCleaningFullColor
AdvertisingCirculars
Qty.100
Packaging:
StockNo. Description
H1189
VersaTileWall&Acoustical
TileCleaningInsertCirculars
Qty.100
VersaTile Self Mailer
General Description: Thisisawonderful,all-in-onemailerthatwill
allowyoutoconductyourowndirectmailing.Itsinformativelayoutwill
allowyoutomailitinandofitselfwithoutstuffingenvelopes.
When to Use: Usetobroadenyourcustomerbase.Thisself-mailerhasa
perforatedpostcardforyourpotentialcustomertoreturntoyou.Simply
stamporprintyournameonthepostcardforitspromptreturn.
Packaging:
StockNo. Description
Form2432 VersaTileSelfMailer
Qty.50
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
25
Equipment
LMX™ Carpet Low Moisture Soil Extraction System
®
APPROVED
General Description:Theonlylowmoisturesoilextraction
carpetmachineonthemarkettosimultaneouslyapplya
dirtemulsifyingdenseaircellbubledetergentandremove
bothdetergentanddirtinasingleforwardmovementofthe
machine.
When to Use:Useanytimeyouwanttocleancarpets
efficiently,professionallyandwithexcellentresults.
Why to Use:Carpetscomebeautifullycleanwithoutthe
hazardsofoverwetting,shrinkage,dryrotandmildew.
Specifications:24”length,17”width,151/2”height,
36”floortotopofhandle.
Packaging:
StockNo.
RB110 Description
LMXCarpetLowMoistureSoilExtraction
System
Esprit™ Upholstery Low Moisture Soil Extraction System
General Description: Oneofthemostversatilepiecesofcleaningequipmentavailable.Keepingupholstered
furnishings atamaximumappearancelevelneednolongerbeasourceoffrustrationanddisappointment.
®
APPROVED
When to Use: Thehighlyportableunit(only45lbs.)
isdesignedtosafelycleanvirtuallyallupholstery
fabricsandcanalsobeusedtocleanstairways,carpet
coveredareas,wheremaneuveringspaceislimited,
on fabric-coveredwallsandpartitions,automobiles,
vans,aircraftandshipsorboats.
Why to Use: Thisuniquemachineeconomically
meetsupholsteredfurnituremaintenance
challengesinaprofessionalway.
Specifications: 30”length,18-1/2”width,
19-1/2”height
Packaging:
StockNo.
UC110 26
Description
Esprit™UpholsteryLow
MoistureSoilExtractionSystem
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
VS MACH l2 “High Speed” Extraction System
General Description: Onepasscarpetcleaningandsimultaneous
recoveryofthedirtladenfoamisidenticaltothetimeproven
principleinvolvedinVon Schrader’sLMX,butattheincrediblerate
ofmorethan10,000squarefeetperhour.
When to Use:Thissystemisidealforlargeareasofcarpet.
Why to Use:You’llbeabletoreducetimeandlaborcost
on largecarpetareacleaningwithverybriefdryingtime
forquickaccessibility.
Specifications:49-1/2”length,28”width,37”heightat
topofhandle.
Packaging:
StockNo.
Description
KB110
MACHl2“HighSpeed”
ExtractionSystem
Aridex™ Upholstery Low Moisture Soil Extraction System
General Description: AsmallerversionoftheEsprit,theAridexalsohas15’hoses.TheAridexissmallerin
sizeandweightbutdeliversbigonperformance.TheAridexmachinehasapowerfulwet/dryvacuumtoprevacuumtheupholsterybeforecleaning.Themachineconvertsdetergentsolutionintoaircellbubbleswithonly
10%moisture.Theuniquebrushinghead,withcounterrotatingbrushesandfoamcontrolswitch,loosens,
breaksdownandtrapsthesoil.Andbecausethefoamislowmoisture,itonlypenetratesthefabricandnotthe
backingmaterials.Onceanareaisclean,thebuiltinvacuumremovesthedirtyfoamandmostfabricsaredry
within30minutes.
When to Use: Ifweightisaconcernandanarrower
frametofitdowntightaislesofaircraftorbuses,the
Aridexwouldbethecorrectapplication.33pounds.
®
Why to Use: Thisuniquemachineeconomicallymeets
upholsteredfurnituremaintenancechallengesina
professionalway.
APPROVED
Specifications: 23-1/2”length,13”width,17-1/2”height
Packaging:
StockNo.
AX110
Description
ARIDEX™UpholsteryLow
MoistureSoilExtractionSystem
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
27
VersaTile Wall/Acoustical Tile Cleaning System General Description: ThisisthenewestadditiontotheVon Schraderfamily.
TheVersaTileSystemistrulyversatilebecauseitcanswitchfromcleaning
acousticaltiletoanytypeofwashablewallandceilingwithvirtuallynoeffortatall.
When to Use: Willcleansmoke,grease,oil,dustandpollutantsinoneapplication.
Why to Use: AcousticalTilereplacementisverycostly.Thatwon’tbenecessary
sincethisnewsystemwillrestoreIndoorAirQualityandappearanceatafraction
ofwhatitwillcosttoreplacethetilealtogether.
Specifications: 42”length,22”width,27”height
Packaging: StockNo.
Description
CW110
VersaTileWall/AcousticalTileCleaningSystem
VS 3 Power Wall Cleaning and Sanitizing System General Description:TheVon SchraderElectricWall
CleaningandSanitizingSystemweighsonly20
poundsandwasheswallsandceilings4timesfasterthanbyhand.
When to Use: Thissystemwasheswallsandceilingsofalltypes:
painted,marble,washablewallpaper,cinderblock,roughcement
block,Spanishplaster,swirlplasterandroughpaintedbrick.
Why to Use: Withmaterialcostsoflessthan50centsperday,
thissystemwillcleanupto6,000squarefeetinone-eight
hourday.Inaddition,thesystemcleans30%fasterthanany
othermachineonthemarketbecauseitinvolvestwosteps
insteadofthree.
Specifications: 19-1/2”length,15”width,14”height
Packaging:
StockNo.
Description
WB110
VS3PowerWallCleaningandSanitizingSystem
28
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
Training
Professional Cleaning School Thecourseisdesignedtoprovideyouwithathoroughunderstandingofcarpetandupholsterytechnologyso
you knowwhatyouarecleaningandhowtoproperlycleanit.
Propercleaningtechniquesandproceduresfor“stainresistant”carpetarereviewed.Von Schrader’sunique
cleaningproductsandservicesgearedtowardStainResistnylonarepartofthecurriculum.
Principles ofcarpetmaintenance,includingpracticaltipstoestablishandimplementcarpetmaintenance
programsinresidentialandcommercialfacilities,arediscussed.
You willalsostudytheuniqueVon SchraderLowMoistureSoilExtractionCarpetCleaningSystemandwhyit
cleanscarpeteffectively.Hands-onexperiencewiththeequipmentinrealisticfieldconditionsisstressed.
Proceduresforremovingdifficultspots,includinghowtousespecialtyspotremovalagentsisincluded.
Duringthecourse,youwilllearnaboutupholsteryfabricsandpropercleaningproceduresforsensitive
fabricslikevelvetandHaitiancotton.
You willoperatetheVon SchraderLowMoistureSoilExtractionUpholsteryCleaningSystem.
You willhavetheopportunitytousetheVon SchraderPowerWallCleaningSystemandtheVersaTile
AcousticalTileCleaningSystemandlearnabouttheprofitpotentialoftheseuniqueservices.
Specialtyservicessuchascarpet/fabricprotectionandodorcontrol/eliminationwillbecovered
fromproductapplicationtechniquestohowtomarketthesehighprofitservices.
Thecourseplacesspecialemphasisonmarketingcarpet,upholsteryandwallcleaningservicestocommercial
andresidentialcustomers.Marketingtopicsrangefromsalesbenefitstobidding/estimatingandfromdirect
mailtoadvertising.
Thecourseemphasizesattendeeparticipationandample
opportunitiesforquestionandanswersonallcoursetopics.
TheVon SchraderSchoolistuition-free.Youpayforyour
transportationtoandfromRacine,hotelandmealswhile
you’rehere.Wewillprovidelunches,andaskyoutobeour
guestoneeveningataSchooldinner.Plus,you’lltakehome
yournotebookandpersonalizedcourseCompletionCertificate.
ContacttheVon SchraderCompanyforschooldates
andlocationsscheduledthroughouttheyear.Also
checkoutourwebsite,www.vonschrader.com,for
additionalinformation.
C .E .C .
InstituteofInspectionCleaning
andRestorationCertification
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
29
PRISM™ Carpet Color Repair Training The “Home Study”, easy-to-learn video training is designed to make you a qualified, confident, on-location
CERTIFIEDCARPETCOLORISTTECHNICIAN.Noother“HomeStudy”programevencomesclose.
The videos go into extensive detail on topics like identifying the market for carpet color repair, what dyes
consistofandhowthey’remade,howcarpetfiberspermanentlyabsorbdyes,techniquesofcoloridentification,
specialcolor-lossproblemsandsolutions;andofcourse,throughone-on-oneandhands-oninstructionandinour
uniquedyeinjectorprocess,dyesprayingtechniques,state-of-the-artcolorsets,andsystemswhicharethebasis
ofthePRISM™ColorRepairProgram.Effectivesalestechniques,residentialandcommercialmarketingprograms,
biddingandestimating,thehistoryofdyes,troubleshootingandwrittenagreementswithcustomersarealsocovered.
Carpet Color Repair Sets When to Use: Use the Carpet Color Repair Set when repairing color
loss spots from accidents such as bleach spills, acne medication, toilet
bowlcleaners,harshliquidsorsunfadedareas.
Why to Use: PRISM™dyesarecolorfast,fade-resistantandlightfast,and
compareinmostwaystocarpets’originaldyes.Theyarepermanentdyes
andaresuperiorfordyeingstain-resistantcarpet.
Packaging: StockNo. Description
11001 ProfessionalColorRepairSet
Includes:(31)pre-mixedpowdereddyes,8oz.Dye
Bond,8oz.DyeSiteCleaner,(2)8oz.BleachEradicator,
8oz.AceticAcid,4oz.Defoamer,(4)measuringspoons,
(2)measuringjars,testvial,scissors,rubbergloves,
(2)dyeinjectors,(5)stirrers,sponge,(2)triggerspraybottles,
pHpaper,towel,(2)eyedroppers,immersionheater,colorchart,
instructionalDVD,instructionalmanualwithcolorguide
anddurablecarryingcase.
30
11009
CompletePrism™HomeVideoWorkshop-SpotColorRepair
IncludesDVDs(7hourstotal),200pageillustrated
TrainingManualwithColorGuide,(8)spottedcarpetsamples
invariouscolors,marketingideas,salesaidsamples.
CertificationExam,CertifiedCarpetColoristGraduation
certificateandshirtpatch.IICRCapprovedforC.E.C.
11011
DVDsonly(7hourstotal)ForAssociatesalreadytrainedand
certified.Idealforretrainingandcontinualreference.
11010
Completekit,lessthetrainingmanual.ForAssociateswhowantto
certifyotheremployeesandsharetheoriginaltrainingmanual.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
National Academy of Von Schrader Associates What Is The N .A .V .S .A .? N.A.V.S.A.isacohesivegroupofcleaningprofessionalswhouseVon SchraderCleaningSystemsandmeet
themembershiprequirements.Membershipisstrictlylimitedtoqualifyingprofessionalcleaners.Asa
memberoftheN.A.V.S.A.,theVon SchraderCompanyrecognizesitsrelationshipwithyouasacleaning
professionalofintegrity,knowledge,skillandcompassionfortheconsumerofcleaningservices.
ByacceptingonlyAssociateswhohaveattendedaVon SchraderProfessionalCleanersSchoolorwhohave
sixormoremonthsofexperience,withaprovenrecordofusingonlyVon Schraderdetergentsandrelated
chemicals,itisthedeterminationofthecompanythatyoumeetthestandardsthatareexpectedtoqualify
formembership.ThedeterminationofstandardsistobemadebyaCommitteeofAssociatesandcompany
members.
The N .A .V .S .A . Mission ThemissionofN.A.V.S.A.memberswillbetousetheirprofessionalknowledgeandexperiencetochange
theperceptionofprofessionalcleanersingeneralandeducatethepubliconthemeritsofVon Schrader
professionalcleaners.
Thedescriptionofcleanerorpractitionerwillbereflectedinneatnessofdress,presentationofdocuments,
conditionsoftoolsandequipment,andahighlevelofintegrityinadvertisingandselling,and,aboveall,
providingahighlevelofvalueinperformanceofcleaningservicesatpricesthatwillbefairtotheconsumer.
Why Should You Join? N.A.V.S.A.operatesasaninformationclearinghouseforthebenefitofitsmembersprovidingallmemberswith
thebenefitoftheexperiencesofothersthroughouttheU.S.A.N.A.V.S.A.willgiveusagreaterunderstanding
oftheneedsofprofessionalcleaners-sowecanhelpmembersbemoreefficientintheirbusiness.
800-826-1600 • 8:00 AM - 4:30 PM CST Monday - Friday
31
®
C O M P A N Y
1600JunctionAvenueTelephone:262-634-1956
Racine,WI53403800-626-6916
www.vonschrader.comFax:262-634-2888
Email:info@vonschrader.com
Orderscanbeemailedto:orders@vonschrader.com
®
2128R
©2012Von Schrader
© Copyright 2025