1. society
2. sex

The Ultimate Penis
Enlargement Guide:
Various sources
Penis Improver - Penis Enlargement System
A Manual Guide To Permanent and Safe Enhanced Sexual Performance.
LEGAL NOTICE: Nothing in this manual is meant as, or should be taken as medical advice. While the techniques
described in this manual have worked well for many men including the author, we are all individuals and they may
not be appropriate for you. Before trying any of the techniques in this manual you should consult with a licensed
Physician and/or Sex Therapist. If you are interested in penis enlargement you should consult a licensed Physician
and/or Urologist. Because no two people are alike and you may have special needs, all penis enlargement techniques
should be done under the supervision of a licensed Physician or Urologist. This manual is meant for informational
purposes only. Neither the Penis Improver developers nor the author shall be liable or responsible for any loss,
damage, injury or ailment caused or alleged to be caused, directly or indirectly by the information or lack of
information, or use or misuse of the methods or techniques described in this manual.
Contents:
Introduction
Health & Nutrition
High Octane Sexual Fuel Diet
Supercharging Supplements
Charging Up Your Batteries
Drugs and other Hazards
Becoming A Man of Steel Penis of Steel Strong as Steel Hard As Steel Lasting All Night Long:
Delay Techniques
Identifying The Point of No Return Techniques Breathing Stop! The Squeeze The External Prostate Point The PG
Pump PC Pumping
Focus Control
Position Yourself for Success
The Medicine Man
Thrusting Techniques
101 Taoist
9 in 1 Tease and Please
Slide and Glide
How to Screw Her Good!
Making it Bigger: The Penis You Always Wanted
The Jelq Technique
The Taoist Techniques
The Stretch Technique
Vacuum Pumps
The Program Attitude & Belief
Visualize the size
Introduction
Congratulations on you purchase of The Penis Improver - Penis Enlargement System Manual. In this manual you
will learn about your penis, you will learn how to make it harder, longer and thicker and even more important as
many women will attest, How To Use It! I will show you how to banish premature ejaculation forever. You will
learn the most ancient and the latest techniques for to gain true mastery of your penis. Before long you will have the
sexual prowess of a porno stud! There is one catch. Like anything else in life, to become a master it takes work,
dedication and consistency. I mean you would not expect to walk into a Dojo (Martial Arts Studio) and come out
with a black belt the same day, or be able to do the splits after stretching only once. Would go to the gym and come
out looking like a bodybuilder after only a few workouts would you? Of course not! The same truth applies here as
well. And the same attitude is required as well. You can make significant gains in size, staying power and technique
but it will require dedication and a commitment on your part. A commitment on your part to follow the techniques
taught to you in this manual on a regular basis. The reason I use the analogy above is that it is quite appropriate, as
we will be practicing techniques like they do in the martial arts. In fact many of the techniques you will be learning
were taught in ancient Asia by the Taoist (pronounced Dao-ist) as sexual Kung Fu. We will also be stretching
tendons and ligaments like they do in the martial arts and like a bodybuilder we will be building muscle as well. So
enough said let's get down to business! The Business of building a Big, Hard, Strong, Penis. And becoming the
master of your sexual destiny.
Health & Nutrition
Your penis is not a separate entity from your body. It is part of your body. So if you are in poor health you should
not expect your penis to be in any better health than the rest of your body. If you are under great stress, deprived of
quality sleep and rest, suffering from an illness or are just malnourished due to a nutritionally deficient diet, you may
lack the penis performance that you desire. But all is not lost as in the next few pages we will cover the basics of
nutrition as well as foods and supplement that specifically enhance sexual performance.
High Octane Sexual Fuel Diet
The food you put into your body is what your body burns as fuel to make energy and just like when you put cheep
gas in your car and you get poor performance the same goes for your body. The quality of food you eat can be a
major factor that helps to determine your energy level, general health and sexual performance. What should you eat?
You might ask? You should eat a well balanced diet with plenty of fresh fruits (apples, bananas, peaches, pears,
grapes, oranges etc.) and vegetables (spinach, broccoli, asparagus, squash, green beans, carrots, etc... green and leafy
vegetables are the best!) If you don't like to eat vegetables you can drink fresh vegetable juice, not canned. When a
product is canned it loses many of its vitamins, nutrients and enzymes, so you should always try to eat fresh foods.
You should also eat a high quality protein every day, such as fish, chicken, and egg whites. I believe that beef meat
should be eating only 1-4 times a month. If you really like red meat, you might try ostrich or buffalo; they are much
leaner and healthier. When you buy your food you should try to get as much of it organic (grown with out pesticides
and without preservatives) as possible. I recommend that you get a copy of the Zone Diet book. It basically says that
you should eat 30% Fat (good fat, avocados, nuts, etc.) 30% Carbohydrates (in the form of non-starchy vegetables)
and 40% Protein (Fish, Chicken, Etc.) at every meal and that you should avoid refined sugar. What you should you
not eat? Refined sugar (candy, soft drinks, pastries, white sugar, brown sugar, etc.) Preservatives (Sodium Benzoate,
Sodium Nitrate, Sodium Ethoborate etc.) Food Additives (MSG or Mono-Sodiumglutinate, NutraSweet or
Aspartame, hydrolyzed animal or vegetable protein these are excitotoxins and stimulate the neurons in the brain until
they die! Food Dyes, etc.) Start reading the packages of what you eat. Look for the hidden sugars (sugar, highfructose corn syrup, maltodextren), preservatives and food additives on the labels of what you buy. A good rule of
thumb is if you can't pronounce it you might not want to eat it. Try to as eat little processed food as possible.
Processed food are ready-made food. Such as canned foods and processed cheese, frozen dinners etc. I don't expect
anyone to forgo all of the above all of the time. I love a good piece of Triple Chocolate Cake or Chocolate Cookies,
but I don't eat it everyday! Better yet save up you chocolate allowance and put chocolate syrup on your woman's
nipples! One more note before we move on. Two things that you should also avoid are aluminum and fluoride,
which is a by-product of aluminum and used as rat poison. Aluminum has been linked to Alzheimer's Disease. You
might ask how you avoid aluminum? Don't drink out of aluminum cans, or cook in aluminum pots and pans. Go get
you're deodorant right now, and read the label, if it says aluminum don't use it anymore. And as for fluoride, from
what I have read from some dentist that have written on the subject, IT DOES NOTHING FOR YOUR TEETH!
And is aluminum by product.
Supercharging Supplements
In addition to healthy foods you can take vitamin and mineral supplements to help make up for what our foods lack
today. I recommend that you see a nutritionist or buy a book on the subject of nutrition. Until you do I will tell you
what I take. Colloidal Minerals, B-Stress Complex, Vitamins C, E, A and Zinc which is very important for prostate
health and in fighting off infections. Many companies are now making zinc lozenges, because if you get enough at
the on set of a cold you could be over the cold in 24-48 hours or at least have less severe symptoms. And now for the
sexual performance boosting supplements: ? B-Stress Complex for more energy ? B-12 For more energy ? Colloidal
Minerals for general health and immunity ? Amino Acid: L-Arginine: for erections of steel and increased volume of
ejaculate. I found this one through an obscure magazine article about a year ago. It Works! I take 500-1000mg in the
daytime and 1000-1500mg about an hour or two before sex. Warning: Do not take L-Arginine during a herpes break
out or when cold sores are present, or any herpes related disease as it will make the case more severe. I also
recommend that you take good a amino acid supplement and augment it with the L-Arginine as not to create an
imbalance in the body. I do not recommend taking high dosages on a daily basis for an extended period of time. ?
Herb: Avina Sativa (Wild Oats): Increases sex drive and volume of ejaculate. ? Herb: Saw Palmetto Berries Extract:
Good for prostate health. ? Herb: Muira Puama Extract: Increases sex drive, and produces firmer erections I have
heard. ? Herb: Yohimbe: Some people have had great success with this herb and claim great results. I don't
recommend it, because I have heard that it has negative side effects if over used or used for extended periods of
time. ? Herb: Damiana: Increases sex drive. I have also heard that the user of this herb will become more attractive
to the opposite sex. ? Herb: Schizandra: It is said to increase the volume of sexual fluids, increase sexual endurance
and staying power and to strengthen the whole body. One Added benefit is that it beautifies the skin. ? Herb:
Epimedium: Also known as "goat sex herb" considered an aphrodisiac. ? Herbal Formula: Honeymooners Tea: This
tea is for replenishing spent sexual energy. Dendrobium, Schizandra, Licorice root. You boil all of the herbs and
drink the tea. There are many great Chinese herbal formulas that may benefit you in countless ways. I recommend
that you see a Chinese Tonic Herbalist to take advantage of them. Consult your doctor and/or nutritionist before
taking any of the supplements or herbs listed here!
Charging Up Your Batteries
If you want to be a sexual athlete you need to get plenty of rest and sleep so that your batteries are charged up so to
speak, So that when you need the Super Sexual Energy it is there. The Ancient Taoist believe that a man should
retain his ejaculate when he has his orgasm so that he does not lose his energy and feel drained after sex as many
men feel. How ever they believed that men should have sex very often without ejaculating in order to cultivate
energy for well being and rejuvenation. Many professional athletes abstain from sex before a competition so that
they are at their peak, energy wise; this may lend some creditability to the Taoist theory. Weather I choose to believe
in the Taoist theory or not one thing I have learned is that you can have sex all day and sleep all night or have sex all
night and sleep all day. But you can't work all day, fight traffic, go to the gym and then have sex all night and get up
for work early the next morning and do it all over again for very long with out it taking toll on your health and
immunity. The Taoist may have the answer to this problem and we will explore in more depth later on, but for now
just realize that you need adequate rest and sleep to have great sex and great erections.
Another Taoist theory is that you tell your health and well being by your penis. According to the theory you can tell
when you are in good health and when I you had enough rest by the firmness of your erections. The harder you are
the healthier you are and the more energy you have. This is not written in stone, but I have found it to be true for me
as the Taoists found it true for them. Drugs and other Hazards As well as all of the other dangers of illegal
substances they can also effect you sexual function in a detrimental way. If you want to be a man of steel you have
to act like one. Moderation is the key here, but I find that some drugs are too dangerous even with moderate usage,
such as cocaine, heroin, and ecstasy have been found to cause brain damage. Many prescription drugs and antibiotics
also may cause loss of sex drive to the point of near impotence. If you are on prescription drugs, and this is the case
you should consult with your doctor, and a nutritionist and/or herbalist for a solution to your problem. Steroids can
be very damaging to your sexual functioning in addition to the possibility of damaging your liver, kidneys and heart.
Some of the side effects of steroids to the reproductive system are that you balls may shrink and you testosterone
production may be significantly reduced. We all know that smoking Cigarettes is bad for your health. But you may
not know what it does to your sexual performance. When you smoke you decrease the blood and oxygen supply in
your arteries and you're sexual performance and firmness of your erection decreases. That would be enough right
there for me to quit! Alcohol in moderation is not bad, in fact medical studies have now shown that 1 drink a day
may even be good for you! We all know that too much alcohol decreases your ability to perform sexually. So once
again moderation is the key. Becoming A Man of Steel If you want to be a man of steel and have a penis of steel you
have to live like a man of steel. Which means that you need to eat like a man of steel, sleep like a man of steel,
exercise like a man of steel. I don't want to turn this into bodybuilding or exercise guide, but I will say that if you are
not already active, you should be. I recommend joining a gym (A great place to meet women) and getting on weight
training program. This will not only make you feel better, but you will also look better and be more attractive to the
opposite sex. If you really can't stand lifting weights, you might try martial arts classes, where not only will you get a
work out but you will also learn to defend your self and increase your self -discipline and self-confidence. Other
suggestions might include Aerobics, Boxercise, Running, or Biking.
Penis of Steel
Now lets get down to business, and build a penis that is as strong as steel, and as hard as steel. In order to do that we
need to first strengthen the muscles that are responsible for your orgasms and ejaculation, the Pubococcygeus muscle
or PC muscle (Figure 1).
But first we need to locate it if you are not aware of it. The best way to find it is to urinate and try to stop the flow of
urine, when the flow stops you have found your PC muscle. Now flex your PC muscle a few times to make sure you
have found it. As with any muscle without use it will atrophy and unless you have been doing a PC muscle workout
already on a regular basis you could probably use some strengthening and toning. So now we will start a PC muscle
exercise program.
Strong as Steel The Strong as Steel Exercise Program
The first exercise we are going to do is the
Quick squeeze:
Squeeze your PC Muscle as tight as you can and hold it for 2 seconds then completely relax the muscle. That is one
rep, wait 1 second between reps. Next is the
Slow Squeeze:
Squeeze your PC Muscle as tight as you can slowly and hold it for 15 seconds then release slowly, completely relax
the muscle. That is one rep wait 5 seconds between reps. And last is the
Super Squeeze:
Squeeze your PC Muscle as tight as you can slowly and hold it for a minimum of 60 seconds then release. That is
one rep wait 60 seconds between reps.
Daily Program:
Quick Squeeze: 20 reps. (work up to 100 reps.) x 1 set.
Slow Squeeze: 10 reps. (work up to 25 reps.) x 1 set.
Super Squeeze: 1 reps. (work up to 10 reps.) x 1 set.
Just as with any exercise program you should start out slow and build up over time, in this case over about 2-3
weeks to prevent excessive soreness. After being on this program for 4-8 weeks you should have a super strong PC
muscle. Which is required for many of the techniques in the following sections. Some of the added benefits of PC
muscle exercises are more intense orgasms, stronger and more powerful ejaculation, and the ability to become a
Multi-Orgasmic Male. PC muscle exercise also promotes good prostate health, by massaging the prostate gland with
the contractions of the PC muscle.
Hard As Steel
There are many different variables that can factor in to the hardness of your penis, such as general health and lack of
sleep that we covered in earlier sections. Another factor is the strength of your PC muscle. The stronger your PC
muscle is the harder your penis will be, and when your penis is at it's hardest, your penis will also be at it's biggest.
Also as mentioned earlier a program of herbs, vitamins and supplements can help turn a weak erection into a Steel
Rod! The ones that I have found to be most beneficial to increase the hardness of erections are the Colloidal
Minerals, B-Complex, and L-Arginine (The Secret Ingredient, this one alone should make you rock hard if taken
correctly and you are in general good health I take 500-2000mg's a day 500-1000mg's in the morning and 5001500mg's 2 hours before sex. Then get ready for a super hard erection, in some cases increased staying power and a
Mega Load Ejaculation. If this does not happen the first time take the dosage for a few days in a row). Lasting All
Night Long A penis no matter how big or hard is of very little use to anyone if you have no control over it. Many
men suffer from premature ejaculation as we will define it (ejaculating before you are ready to.) This can be a great
insecurity to a man's sexual self-image and cause much frustration to his sexual partner as well. Now we will learn
some techniques to help end this problem forever!
Identifying The Point of No Return
Before you can control your ejaculation you must be able to recognize when it is that you are going to ejaculate or,
as we will call it the point of ejaculatory inevitability or the point of no return( P.O.N.R). In order do this you have
to do some exercises so that you will be able to identify your P.O.N.R.
Exercise #1:
Finding your P.O.N.R. and Excitement Scale.
Goal: Finding your P.O.N.R. and Excitement Scale.
Repeat until you accomplish the goal to your satisfaction.. You will want to take about 30 min. to do this. You
should do this alone and without any added stimulation (Pornographic Material unless absolutely needed). You
should pay attention to every nuance and subtle feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all of the feelings you feel along the way to
your P.O.N.R.
2.
3.
4.
5.
6.
7.
8.
Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5, etc.(1 being lowest or semi-hard and 10
highest and the P.O.N.R.) along the way to your P.O.N.R.
Try to stay at each level for about 2-3 min. Then move to the next.
Notice what it is that moves you to the next level i.e. the speed of your stroking, the tightness of your grip, what
you are thinking etc.
Move slowly to each higher level as to not get carried away and ejaculate with out finding your P.O.N.R.
When you get to a level about 9-9.5 pay real close attention to what you are feeling. You should start to feel the
seamen moving from the testicles and collecting in the prostate gland at the base of the penis.
If possible stop and take a deep breath and feel everything. If you can't stop then you have passed your P.O.N.R.
See how close you can get, then let your self ejaculate and enjoy it! Now that you have identified your P.O.N.R.
and you can tell when you are approaching your P.O.N.R. all you need is to learn how to slow your path to
orgasm which we will cover in the next section.
Delaying Your Orgasm
Now we will cover several techniques in this section that will enable you to Delay and/or prevent your orgasm and
prolong lovemaking for as long as you desire. Some of the techniques will work better for you than others and many
can and should be used in conjunction with each other.
We will start with the simplest leading to the more advanced with each technique building on the previous.
Delay Techniques:
Breathing This one is fairly simple but very powerful when combined with the other techniques. That is why you are
going to learn it first. First we need to see if you know the proper way to breathe. Put your hand on your abdomen
and take a deep breath, you should feel your abdomen fill with air and your abdomen expand outward. Your
shoulders should not rise. Practice breathing like this until you get it down. When you feel that you are reaching
around 7.5 or 8 on the Excitement Scale take a slow deep breath and hold it for a few seconds until the urge to
ejaculate subsides. Continue slow deep breathing until your level on the Excitement Scale drops a few points.
Warning: don't hold your breath too long you don't want to get dizzy or pass out! This technique may or may not
work for you depending on how close to your P.O.N.R. you are, but is very powerful when used in combination with
the following techniques.
STOP !
That's it! Just stop and breathe! (As described above) When you feel that you are getting too close to your point of
no return, just stop what ever it is you are doing take a deep breath and just wait 20-60 seconds before you resume
any form of stimulation. Once you feel that your arousal has dropped a few points on your excitement scale you then
can resume stimulation. The key to making this work is to really stop. If you are with a lover you maybe concerned
that you will look silly or deprive her of her pleasure. If you use finesse you will be able apply this technique
properly without either of the two happening. The key to doing this is not to let your lover feel isolated during your
break. Scenario A: Let's say your lover is going down on you and you are getting close to your P.O.N.R. and you
haven't had intercourse yet.
A few ways to handle this are as follows:
1. Say "baby, that feels so good, but I don't want to come yet! Could you stop for a few seconds!" Most women
would be very happy to help you out, especially if your are with a steady lover.
2. Say " Ohh, God you are so good!, Come here!" and pull her up, take a deep breath and kiss her passionately
during the 30 seconds or so..This will only turn her on more and still give the break you needed..Then you can
gently guide her back down there or move on to another activity. If you need even more of break you could suck
on her nipples or go down her..
3. Pull her up and say " My Turn!" and go down on her while you take your needed break. Very few women will
argue with this request!
Scenario B: You are having intercourse and you can tell that it won't be long before you reach your P.O.N.R. A few
ways to handle this are as follows:
1. Say "baby, Your pussy feels so good, but I don't want to come yet!" Stop, Pull out, take a slow deep breath (If
just stopping without pulling out works for you then great, but many times it won't be enough, also she my keep
moving especially if she is on top) and take a break. Most women are very happy to help you out, especially if
your are with a steady lover. WARNING: If your lover is screaming "Don't stop I'm about to come", this is not
the time for this technique, even if you want to last past her orgasm.
2.
Stop, take a deep breath and, change positions. This will only work if you have been in one position for awhile.
Also the best position to move to is her favorite, unless this was it! Then you might not want to change.
3. Pull out, take a deep breath, tell her how pretty her pussy is or how much you love her pussy, go down and kiss
her or her pussy a few times, while you take a break.
4. Pull out, take deep breath, slide the shaft of your penis over her clitoris with a thrusting motion, and rub her
clitoris with the head of your penis and/or playfully slap and tease her pussy with your penis, while you say
something like "You like being naughty don't you, I love your naughty little pussy!" or some other verbiage that
you come up with.. Be creative.
Exercise #2:
Solo Practice - The Breathing and Stop! Techniques.
Goal: Experiencing and becoming familiar with the Stop! and Breathing Techniques.
Repeat until you can confidently and successfully apply the technique to delay your ejaculation and prolong sexual
stimulation. You will want to take about 45min. to do this. You should do this alone and without any added
stimulation (Pornographic Material unless absolutely needed). You should pay attention to every nuance and subtle
feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all of the feelings you feel along the way to
your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5, etc.(1 being lowest or semi-hard and 10
highest and the P.O.N.R.) along the way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your stroking, the tightness of your grip, what
you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate with out trying the technique.
6. When you get to a level of about 6.5 apply the technique: Stop, Take your hand off of your penis, take a deep
breath and hold for a few seconds, slowly let the breath out and relax as your Excitement level drops a few point
on the scale. Pay very close attention to what you are feeling as this happens. Start stimulating you're self again
and repeat the above technique at levels 7.5, 8.5, 9.5.
7. See how close you can get each time, then let your self ejaculate and enjoy it!
The Squeeze
The Squeeze technique is just what it sounds like you Squeeze your penis with your hand.
When feel like you are getting near your P.O.N.R. you do The Squeeze in combination with the previous Breathing
and Stop! Methods.
The Squeeze Technique:
1. When you feel close to your P.O.N.R. you, stop, pull out, take a deep breath and squeeze your penis hard with
your thumb and first two fingers for several seconds. After your Excitement level drops a few points you may
resume intercourse. The squeeze should be applied either with the first two fingers (this is a flat grip the fingers
and thumb do not meet.) just below the head of the penis.
2. Another variation is to squeeze you penis at the base instead of just below. This can be done in the same manner
described above or by gripping the penis in a ring manner with the thumb and index finger. Try both and see
which works best for you. You may also be able to use the last variation of griping the penis at the base without
having to pull out, and simply just stopping, taking a deep breath and applying the squeeze to the base of the
penis and waiting till the urge to ejaculate subsides.
Exercise #3:
Solo Practice - The Squeeze Technique.
Goal: Experiencing and becoming familiar with the Stop!, Breathing and Squeeze Techniques. Repeat until you can
confidently and successfully apply the technique to delay your ejaculation and prolong sexual stimulation. You will
want to take about 45min. to do this.
1. You should do this alone and without any added stimulation (Pornographic Material unless absolutely needed).
You should pay attention to every nuance and subtle feeling that you will feel.
2. Start with a limp penis and begin stroking until you are hard. Notice all of the feelings you feel along the way to
your P.O.N.R.
3. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5, etc.(1 being lowest or semi-hard and 10
highest and the P.O.N.R.) along the way to your P.O.N.R.
4. Try to stay at each level for about 2-3 min. Then move to the next.
5.
6.
7.
Notice what it is that moves you to the next level i.e. the speed of your stroking, the tightness of your grip, what
you are thinking etc.
Move slowly to each higher level as to not get carried away and ejaculate without trying the technique.
When you get to a level of about 6.5 apply the technique: Stop, squeeze your penis hard with your thumb and
forefingers just below the head or with the ring grip at the base of the penis( I recommend that you try both
variations and see which one works best for you), take a deep breath and hold for a few seconds, slowly let the
breath out and relax as your Excitement level drops a few point on the scale. Pay very close attention to what
you are feeling as this happens. Start stimulating you're self again and repeat the above technique at levels 7.5,
8.5, 9.5. 8. See how close you can get each time, then let your self ejaculate and enjoy it!
The PG Pump
The PG Pump is actually an ancient Taoist technique to delay ejaculation and can also be used during orgasm do
prevent ejaculation.
To use the PG Pump you must first find your external prostate point. The point is located on the perineum between
your scrotum and anus, but closer to your anus (Figure 1). The PG Pump technique can be applied with or without
pulling out, however the effect is greater if you do pullout.
Exercise #4:
Finding your External PG Point. Goal: To Find your External PG Point and become familiar with the sensation of
pumping it.
1. Stimulate your self until highly aroused highly.
2. You should be standing or in a kneeling position. Reach around behind your butt and between your legs, then
with your first two or three fingers (depending on the size of your fingers) and press up on the area above your
scrotum and just below your anus fairly hard up to the first joint of your fingers.
3. When you find the right spot you will feel a pleasurable sensation and you will be able to see the head of your
penis throb and expand as you press.
4. Press it a few times slowly and gently.
Now you know how to pump your prostate.
Now that you know where your External PG point is and how to pump your Prostate lets apply this technique to
practical use.
Exercise #5:
Solo Practice - The PG Pump Technique.
Goal: Experiencing and becoming familiar with the Stop!, Breathing and PG Pump Techniques.
Repeat until you can confidently and successfully apply the technique to delay your ejaculation and prolong sexual
stimulation. You will want to take about 45min. to do this. You should do this alone and without any added
stimulation (Pornographic Material unless absolutely needed). You should pay attention to every nuance and subtle
feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all of the feelings you feel along the way to
your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5, etc.(1 being lowest or semi-hard and 10
highest and the P.O.N.R.) along the way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your stroking, the tightness of your grip, what
you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate without trying the technique.
6. When you get to a level of about 6.5 apply the technique: Stop, press hard on your PG Point for several seconds,
release (that is one pump). Pump your PG Point 3-5 times, take a deep breath and hold for a few seconds, slowly
let the breath out and relax as your Excitement level drops a few points on the scale. Your erection may
decrease a bit as well. Pay very close attention to what you are feeling as this happens. Start stimulating you're
self again and repeat the above technique at levels 7.5, 8.5, 9.5.
7. See how close you can get each time, then let your self ejaculate and enjoy it!
The PC Pump
The PC Pump is a internal and more powerful version of the PG Pump, but instead of using you fingers to press on
your external prostate point and pump your prostate gland you are using Pubococcygeus muscle or PC muscle to
pump the prostate gland.
To explain how this delays ejaculation we first need to understand how ejaculation occurs.
When you near you're P.O.N.R. you prostate starts to fill with prostatic fluid and fluid from the seminal vesicles.
Once you reach your P.O.N.R seaman is drawn from your testicles into the prostate gland and then expelled with
force by the contractions of the muscles that surround the prostate gland. With the PC Pump and the PG Pump what
is actually happening is that you are interrupting this process and restarting it in effect. To be able to do the PC
Pump you must have a very strong PC muscle. If you have been doing some kind of PC muscle conditioning might
want to try the exercise now, if not you should start training and strengthening your PC muscle with the Strong as
Steel Exercise Program as outlined earlier in this manual.
After a couple of weeks of training you should do try this exercise. Remember that you should continue the Strong
as Steel Exercise Program indefinitely to maintain a strong PC Muscle. As with the PG Pump, The PC Pump can be
applied with or without pulling out.
Exercise #6:
Solo Practice - The PC Pump Technique.
Goal: Experiencing and becoming familiar with the Stop!, Breathing and PC Pump Techniques.
Repeat until you can confidently and successfully apply the technique to delay your ejaculation and prolong sexual
stimulation. You will want to take about 45min. to do this. You should do this alone and without any added
stimulation (Pornographic Material unless absolutely needed). You should pay attention to every nuance and subtle
feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all of the feelings you feel along the way to
your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5, etc.(1 being lowest or semi-hard and 10
highest and the P.O.N.R.) along the way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your stroking, the tightness of your grip, what
you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate without trying the technique.
6. When you get to a level of about 6.5 it is time to apply the PC Pump: There are several variations of the PC
Pump technique, try them all and see which one works best for you. A. Stop, Flex your PC hard for 2-3 seconds,
release (that is one pump). Pump your PC Muscle 3-5 times, take a deep breath as you do the first pump and
hold for a few seconds, slowly let the breath out and relax as your Excitement level drops a few points on the
scale. You may also experience a decrease in your erection. Resume stimulation. B. Stop, Flex your PC Muscle
hard for one long pump about 10 seconds, release. Pump your PC Muscle 1-3 times, take a deep breath as you
do the first pump and hold for a few seconds, slowly let the breath out and relax as your Excitement level drops
a few points on the scale. You may also experience a decrease in your erection. Resume stimulation. C. Stop,
Flex your PC Muscle hard for 1 second release and do it again quickly, repeat for 5 reps., take a deep breath and
hold for a few seconds, slowly let the breath out and relax as your Excitement level drops a few points on the
scale. You may also experience a decrease in your erection. Resume stimulation.
7. Pay very close attention to what you are feeling as this happens. Start stimulating you're self again and repeat
the above technique at levels 7.5, 8.5, 9.5.
8. See how close you can get each time, then let your self ejaculate and enjoy it!
Focus Control
These techniques are more mental than physical and since the mind is the greatest sex organ these techniques are
very powerful when combined with the ones above. These techniques work by you directing your attention away
from your orgasm and onto other sensations, and at the same time keep you fully present in the sexual experience.
Change your focus of goal:
This is the easiest of them, this is more an attitude than a specific technique. Change your focus and goal from
having an orgasm and ejaculation to enjoying and taking in the whole sexual experience. the smell of her hair.. The
feel of her skin, the way she tastes.etc.By taking the focus off of ejaculation and putting it on the whole experience,
everything you do does not lead to ejaculating, but to enjoying.
Exercise #7:
Solo Practice - Change your focus of goal.
Goal: Experiencing and becoming familiar The Focus Control Techniques
1. You will want to take about 45min. to do this. You should do this alone and without any added stimulation
(Pornographic Material unless absolutely needed). You should pay attention to every nuance and subtle feeling
that you will feel.
2.
This time you are going to self-stimulate with the goal be pleasure, instead of ejaculation you do not even have
to ejaculate at all. Start with a limp penis and begin stroking until you are hard. Notice all of the feelings you
feel along the way to your P.O.N.R.
3. Enjoy it! Change your focus of physical sensation: In this one what you do is to take you attention off of your
genitals and place them on another part of your body.
Exercise #8:
Change your focus of physical sensation.
Goal: Changing your focus off of your genitals and put it on some other part of your body.
Repeat until you accomplish the goal to your satisfaction.. You will want to take about 30 min. to do this. You
should do this alone and without any added stimulation (Pornographic Material unless absolutely needed). You
should pay attention to every nuance and subtle feeling that you will feel.
1. Once again let pleasure be your goal, instead of ejaculation. Start with a limp penis and begin stroking until you
are hard. Notice all of the feelings you feel along the way to your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5, etc.(1 being lowest or semi-hard and 10
highest and the P.O.N.R.) along the way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your stroking, the tightness of your grip, what
you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate with out finding your P.O.N.R.
6. When you get to a level about 6.5, shift you attention from what you are feeling in your genitals to what the rest
of your body is feeling. Feel what your hands feel, feel what your skin feels.
7. If possible stop and take a deep breath and feel everything.
8. See how close you can get, then let your self ejaculate and enjoy it!
Change your focus on the external stimuli of your lover:
Many times what drives you past the point of no return is not just something that you are feeling but also what you
are seeing and hearing and what your focus is on. For instance maybe you can last without a problem until you lover
starts to moan and scream, and when your hear how excited she is it throws you past the your P.O.N.R. Or maybe it's
when you see her beautiful full breasts hanging down while you are thrusting into her from behind or any number of
things. The point is to identify what it is that drives you past your P.O.N.R. and then change you focus to something
else about your lover. Many men change their focus to sport scores or something that turns them off, I personally
don't think that you should think of something that you find distasteful or negative to delay your ejaculation as you
may accidentally create an association between the two. If you feel that this form of detachment may help you,
change your focus to anything pleasant that is non-sexual in nature instead. However, I feel that it is better not to
remove yourself from your present sexual experience with your lover. It would be preferable to change your focus to
how much you love or care about her, how beautiful she looks, how amazing the experience is, take in the whole
experience the ambiance, the mood, feel the sheets etc. Just change you focus to anything that is present except the
stimulus that drives you over the edge.
Exercise #9:
Change your focus on the external stimuli of your lover
Goal: Changing your focus off of the part of her or the experience that drives you over the edge and on to something
else.
Repeat until you accomplish the goal to your satisfaction..
1. Once again let pleasure be your goal, instead of ejaculation.
2. Notice what it is that moves you up the scale. I.e. looking at her breast bounce, watching your penis sliding in
and out of her, the way her ass looks, hearing her moan or what she is saying to you.
3. When you start getting close to your P.O.N.R. change your focus off of whatever it is that is driving you wild
and on to something else. i.e. if you are watch her breast and it's driving you wild, look into her eyes instead, if
you are doing it from behind and her ass is just too much for you look at the wall for a while
4. Apply one of the other techniques that you learned earlier, like The PG Pump or the PC Pump, both of which
can be done without pulling out.
5. See how close you can get, then let your self ejaculate and enjoy it!
A Final Word on the Above Techniques With all of the above techniques you don't want to wait until you are at your
P.O.N.R. before you start to use them. But rather use them along the way to your P.O.N.R. so that you may last as
long as you desire and reach your P.O.N.R. and enjoy your orgasm when you are ready rather than to be at the
mercy of chance or to just put up with premature ejaculation. You may never have to hear again the words "I was
almost there, I was so close." Instead, once you master these techniques you will be hearing, "Ooooh, God, I'mmmm
coming, Ooh! Fuck, Oooh! Ooooh! Ooooooooh!
Position Yourself for Success
Having intercourse in certain positions will help to last longer and prolong intercourse.
Positions that prolong intercourse:
The Woman on top positions, Spoons (side to side, man behind the woman).
The Medicine Man
Even though we already covered herbs and supplements earlier I would like to mention a few that are help to
increase staying power. Supplements and Herbs for staying power: ? Amino Acid: L-Arginine: for erections of steel
and increased volume of ejaculate and increased staying power. I take 500-1000mg in the daytime and 1000-1500mg
about an hour or two before sex.
Warning: Do not take L-Arginine during a herpes break out or when cold sores are present, or any herpes related
disease as it will make the case more severe.
I also recommend that you take a good amino acid supplement and augment it with the L-Arginine as not to create
an imbalance in the body. I do not recommend taking high dosages on a daily basis for an extended period of time. ?
Herb: Schizandra: It is said to increase the volume of sexual fluids, increase sexual endurance and staying power and
to strengthen the whole body. One Added benefit is that it beautifies the skin. Strongest in the tincture (Liquid in
alcohol base) form. Should be taken on a daily basis according to the rules of Chinese tonic herbalism. MMO or
Male Multiple Orgasm What is it? MMO or Male Multiple Orgasm is the ability experience all the sensations of
orgasm without ejaculation, and therefore you can maintain an erection and have many orgasms without ejaculating,
until you desire to ejaculate. Some men have developed or inherently posses this ability it seem while most other
men can learn to develop this ability. The first prerequisite is a very strong PC muscle, so if you haven't developed
your PC muscle yet, forget about MMO until you do. Secondly you need a high degree of ability with the PC Pump
Technique. You should be able to stop your self from coming at the 9.5-9.9 levels. If not keep practicing until you
can.
Once you can do that you must learn to stretch the duration of the sensations that you feel when you are applying the
PC Pump Technique sensations.
A Technique for experiencing MMO:
Try the following technique during self-stimulation or intercourse.
1. When you get to a level of about 6.5 apply the PC Pump Technique Stop; Flex your PC muscle for several
seconds, release. Take a deep breath and hold for a few seconds, slowly let the breath out and relax as your
Excitement level drops a few points on the scale. Your erection may decrease a bit as well. Pay very close
attention to what you are feeling as this happens. Start stimulating you're self again and repeat the above
technique at levels 7.5, 8.5, 9.5, 9.6, 9.7, 9.8,
2. Now Try it at 9.9 and right before your P.O.N.R. flex your PC muscle hard, for as long as you can, take a deep
breath and hold it for a few seconds, Open your eyes, and keep them open. Think of bringing the feeling up and
through your whole body.
3. Now if you did all of the steps correctly and you did not pass your P.O.N.R. and your PC muscles was strong
enough. You should have had a MMO without ejaculating, and you should still have an erection or partial
erection and be able to resume stimulation.
4. If that's not what happened, then keep practicing and soon you will be a multi-orgasmic man.
Thrusting Techniques 101 Taoist Techniques and The Taoist 9 in 1 Technique
The Ancient Taoist had developed an extensive array of thrusting techniques for intercourse. They believed that the
man should vary his thrusting speed and thrusting depth and thrusting angle in order to fully stimulate his lover and
himself during a prolonged coition (Taoist also believed in prolong acts of intercourse and are famous for the term
1000 loving thrusts.) They also gave names to the different levels of depths in the vagina. They are as follows: 1.
Lute String, the depth of one inch inside.
2. Water chestnut Teeth, the depth of two inches.
3. Little Stream, the depth of three inches.
4. Black Pearl, the depth of four inches.
5. Valley's Proper, the depth of five inches.
6. Deep Chamber, the depth of six inches.
7. Inner Door, the depth of seven inches.
9. North Pole, the depth of eight inches.
The Taoist 9 in 1 Technique
The 9 in 1 technique is a thrusting sequence in which you simply thrust 9 times shallow (1 to 4 inches) and 1 time
deep (3 to 5 inches, but not so deep as to hit her cervix and cause pain). Example of one set: Shallow Deep 1 9 2 8 3
7465565738291
Then you repeat the sequence over and over again varying the speed of the thrusts. It is said that this sequence will
stimulate the woman to all nine levels The Ancient Taoists also describe nine different types of thrusts. I have
endeavored to paraphrase from the overly poetic language used. The Nine type of thrusts:
1. Thrust to the left and to the right to stimulate the vaginal walls.
2. Thrust up and down rather than in and out. You have to move your whole body up and down do this in the
missionary position.
3. Teasingly pull out and push back in.
4. Alternate between using deep thrusts and shallow teasing strokes.
5. Make deep and shallow strokes in steady succession.
6. Push in slowly.
7. Thrust Swiftly.
8. Poise at the opening, then strike swiftly and stay inside for a few moments.
9. Rise and then plunge low.
Tease & Please
In this technique you tease your partner with your penis until she is begging you to put it in her then you slowly
enter her an inch at a time until you tease an orgasm out of her.
The Tease & Please Technique:
1. After your partner is highly aroused from foreplay, you gently rub your partner's clitoris with the head of your
penis. Every once in a while tease the opening with the head of your penis. After a few minutes of this she will
be simmering with desire, but you want her boiling so keep on teasing.
2. She will ask you to put it in! DON'T PUT IT IN YET! Keep teasing and talk to her. Tell her how beautiful her
pussy is. Ask her if she wants you inside her or if she want's you cock inside her. Ask her how badly she wants
it as you keep teasing her. After a few more minutes of this she will be on the edge of her seat and almost
boiling with desire.
3. When she really can't stand it any longer, start rubbing the opening with the head of your penis for about a
minute or so. Then slide only the head in and vary slowly thrust in and out with only the head of your penis. She
will be begging for you to put it in more!
4. Slide it in one more inch, then trust slowly in and out but only to this same depth. Keep talking to her while you
do this. Ask her if she likes your cock inside her, tell her how much you like fucking her and how good her
pussy feels.
5. After a couple more minutes slide it in one more inch and then thrust slowly in and out to this same depth.
6. Repeat step 5 until you are almost at your full length, but don't put it all the way in until she starts having an
orgasm.
7. Once she starts having an orgasm you may start thrusting more vigorously and or move on to a different
technique.
Slide and Glide
This one I originally learned form an uncle of mine who told me of this great technique he used to give women
orgasms during intercourse that had never had one during intercourse before. A few years later I saw that a book (by
the title of "The Perfect Fit" had been written about a very similar technique, but with much fluff added to fill up 100
or so pages. This technique relies on stimulating your partners clitoris with the friction and pressure from your upper
pubic region (right above your pubic bone) which we will call the Friction Zone (Figure 3).
The Slide and Glide Technique
The technique is done in the missionary position (there is a Woman on top variation that I will go over later). Make
sure your partner is well lubricated, and I would recommend starting with the tease & please technique, until you are
almost all the way in and then start do this technique.
The Slide and Glide Technique:
1. In the missionary position, make sure your partner's clitoris and upper vaginal area is well lubricated. (With her
own juices, you saliva, Astroglide, Wet, etc.)
2. Ask the woman to spread her vaginal lips with her hands, when she does this put your penis in up to the base
and rest the Friction Zone on her clitoris.
3. Put your weight on her body, and reach down and grab her ass and spread the cheeks apart.
4. Now start sliding up and down on her (not in and out, you penis should remain in completely inside her all the
way to the base as you move. To do this you will need to grab her shoulders or the edge of the bed with both
hands and push off with your toes as well. As you do all of this make sure that the greatest friction between you
and her is where the Friction Zone and her clitoris meet. This might all sound really complicated but it is
actually very easy, and after a few minutes you and her will be gliding back and forth on a sweet layer of sweat.
5. Continue until she has at least one orgasm. Keep moving and try not to break the friction.
How to Screw Her Good!
If you follow the techniques above you will be a good lover but you want to be a Great Lover so here is the icing on
the cake. Many men just thrust in and out over and over again, or worse just put it in and pound. While many women
do like to be pounded on occasion or after they have warmed up with an orgasm or two, the same thing over and
over again can get quite boring. It is best to vary the techniques that you use and to vary the types, depth, speed, and
angles of your thrusts as well as the positions that you are thrusting in. Just as well don't get carried away and keep
changing positions every couple of minutes if your partner really enjoys the one you are in and is getting the
stimulation that she needs for an orgasm. To be a great lover you have to learn to read your lover adapt and go with
the flow and still be able to take the lead. You need to learn the way of your lover, what she desires and what she
does not desire, what spots get her off and what really turns her off. These things come with time. That is why the
sex should get better the longer you are with someone not worse..
A few Suggestions:
1. Always tease a bit and make sure that your lover is fully aroused and lubricated before penetration.
2. Make sure your lover is highly aroused and almost coming before full penetration.
3. Thrust at different angles in the same position to stimulate all the walls of the vagina. Try riding high and low,
left and right in the same position to stimulate all of her vaginal walls.
4. Try different positions, variety is the spice of life.
5. Thrust at different speeds, fast, slow, and medium.
6. Thrust hard, soft and teasingly.
7. Once in a while pull out and re-enter.
8. Try thrust in a winding circular motion going in and coming out.
9. Put you penis all the way in and slide up and down and left and right and in circles clockwise and counterclockwise, without moving your penis in and out.
Making it Bigger: The Penis You Always Wanted
We all ask the question does size matter? Sure it does, If you are too big she won't sleep with you! There are some
woman that only like big cocks and there are some that don't like big cocks. I personally have run in more of the
later than the former. According to the famous East Indian love text the KAMA SUTRA both men and women come
in three sizes, essentially: Small, Medium and Large. And the most important thing is for them to fit well together. A
small man with a large woman is not a good match, she will not get they will not get the stimulation they need and
vice versa A large man with a small woman also is not a good fit as it will be painful for her or she may refuse
intercourse all together. Visually, a larger penis turns on some women (But not as many as men who are turned on
by having a larger penis) Most women like medium to big cocks in general, but not huge cocks, they are actually
afraid of them.. Also you have to realize that a woman's interpretation of medium and big are different than ours.
Most women think big is 6-7 inch and about 5 inches around and we seem to think that big is 8-9 inches and 6-7
inches around. Women also seem to favor thick or girth over length, a thicker penis will stimulate the woman more
by stretching her vaginal walls and creating more friction. While men seem to be mostly preoccupied with length.
Let me say that being a Great Lover does not have much to do with penis size. You can have a big cock and be a
lousy lover or you could have 4 1/2 inches and be a Great Lover.
What makes a great lover is the feeling and passion that you channel through great sexual technique. A great lover is
more than a penis and knows how to use his eyes, his voice, his words, his tongue, and his whole body as well as his
penis. If you just happen to have a big cock, so much the better. Before I go on to the enlargement techniques, I
would like to point out the advantages and disadvantages of having a larger penis. The Advantages of Having a
Larger Penis: ? Increased self-confidence and self-esteem. ? Visually more of a turn on to your lover. ? Looks good
in the locker room. ? Looks good in your pants. ? May stimulate your lover's vagina more. The Disadvantages of
Having a Larger Penis: ? If your penis is very big (8+ long, 6.5+ around) some women may refuse you intercourse. ?
If your penis is very long (8+ inches), it will hit the woman's cervix and cause pain, so you will have to thrust more
carefully and not go all the way in. Part of your penis (the first couple of inches) will get left out in the cold. ? If
your penis is very long you will rarely get deep throated. If it is very thick it will be hard for most women to put
your penis in their mouths. And if they can you may get hit by there teeth, if they don't know what they are doing. ?
If you are a fan of anal sex, the bigger you are the less chance you will have of getting a woman to try it. ? If
intercourse is difficult for your partner because of your size, you may have sex less often. Now that you know the
long and short of it, Let's move on to making it bigger!
YES! YOU CAN MAKE YOUR PENIS BIGGER!
You may have ask the question can I make my penis bigger and depending on who you asked you might have gotten
back "No" or vague or unsatisfactory answers or worse. Maybe someone looking to profit from desperate individuals
looking for an answer has even taken you advantage of. There are even mail order companies that sell creams that
claim to enlarge your penis or that advertise "add three inches to your penis over night, with a prosthetic
enlargement device" making money off of people's ignorance of the word "prosthetic", which means artificial
replacement. So they sell you a fake penis that fits on top of yours! How many people do you think will complain to
the Postmaster General that the Penis Enlargement Cream didn't work!
Like I said in the Introduction of this manual, Yes You can enlarge you penis if you are willing to make the
commitment to do the proper techniques on a regular and/or daily basis for an extended period of time. If you are
willing to make this commitment you can make significant gains in the girth and length of your penis.
The minimum amount of time that you should consider is six months, however you will start to see gains before that
(individual results will vary). It's like any other personal development or skill that you learn, if you want a Black
Belt in the martial arts, it may take you 2-8 years depending on the style, If you want to get muscle and look like a
body builder it may take you a 6-2 years. If you want to have the penis you always dreamed of and see results along
the way, it may take 3 months -2 years. So in all of the above cases you can either bitch about how long it will take
and give and quit or you can make a commitment to your goal and do a little work toward it every day and be for
you know it you have reached your goal and seen results along the way.
Warning:
Because no two people are a like and you may have special needs, all penis enlargement techniques should be done
under the supervision of a licensed Physician or Urologist. Penis Enlargement Techniques There are many different
techniques to add both girth and length to your penis. Some of them you might appeal to you and others might not. It
also depends on what your goals are.
Before we go any further go get a tape measure
(The kind used in health clubs and my tailors and a ruler. Now measure your penis first in the flaccid (soft) state by
putting the ruler on above your penis flat against your pubic bone or the base of your penis and record the
measurement. Next take the tape measure and wrap it around your penis and record that measurement. Now
stimulate yourself until you are as hard as you can get! If you are not as hard as you can get your measurement will
not be accurate. Now repeat the measurement process as described above and record the measurements on one of the
sheets provided at the end of the manual. You can check as often as you like during the program, but I recommend
that you only record on the sheet every month, as day to day measurement will fluctuate.
Now that you have your measurements let's how you measure up to the average?
Erect Length: Erect Girth: Small - less than 5" Less than 4 3/4"
Circumference Average 5" - 7" 4 3/4" - 5 1/2"
Circumference Large 7" - 9" 5 1/2" - 6 1/2"
Circumference Huge 9"+ over 6 1/2"
So where do you fall on the chart? Now that you know how big you are and what is average, you need to decide how
big it is that you want to be? As with anything in life set reasonable goals for your self. If you are 4 inches don't set
your self a goal of 10 inches in length. I am not going to say that it is impossible, but a more reasonable goal would
be six inches if you starting with 4. For length I would recommend that you go no greater than 2" from where you
are now. Try that out for a while and if you want more than continue with the techniques. Also as for girth same
rules apply, however it is much easier to gain girth if you are using the Hyperemiation technique. Again set
reasonable goal and besides anything over 6 - 6.5 in circumference is really BIG!
Methods of Enlargement
There are many methods and techniques of penis enlargement, some focus on lengthening the penis, others focus on
thickening the penis, and some do a little of both. We are not going to cover all of the available techniques out there,
but rather the ones that we have found most beneficial and proven.
Hot Compresses or Warm Water Soaking
Before any of the other techniques, this one should be done first, as it will help to expand the blood vessels in the
penis and increase the flow of oxygen fresh blood in the penis, preparing it for the following techniques. Now for
the first step, either:
1) Wrap your penis in a washcloth filled with warm water.
2) Get in the bathtub and run warm water over your penis by putting your penis under the faucet (test the water first
with your hand, so you don't burn your self.
3) Soak In a Warm Bath. Do any of these for 5-15 minutes. This will help to expand tissues of the penis and bring in
more fresh oxygen rich blood. After this step you penis will have a pink hue and be slightly swollen.
Manual Techniques The Jelq Technique or Milking the Penis
The Jelq technique is an ancient method of penis enlargement from the Middle East. Traditionally it was taught
father to son when the child reached adolescence. In wealthy families the as the boy grow older he may be sent to a
"Mehbil" a gym or health club where a highly-train attendant will perform the Jelq technique on the boy on a daily
basis and as a result of these daily treatments his penis grow to dimensions that it would not have attained had he not
used the technique. This technique also works on the fully developed adult penis as well. The Jelq Technique:
1. Start with flaccid penis; put some oil or lubricant on your hands and penis.
2. Grip your penis with an overhand grip with your thumb and index finger.
3. Squeeze gently and milk your penis down to the head, stretching your penis as you go. When you get to the head
start the movement over with the other hand.
4. Do the technique over and over again for 30 minutes alternating each hand as you go.
If you start to get hard or feel the urge to ejaculate stop and wait until it passes and your erection subsides a bit and
then continue, as this must be done with a semi-hard penis for it to work. Tip: Make sure that you have more than
enough lubricant on your hands and penis. The best lubricant I have found is Albolene liquefying cleanser, which
can be found in the cosmetic section on most drug stores. Women use it for removing makeup, but is also makes a
great sexual lubricant(oil based, do not use with condoms ever during sex). This product has been used in the porn
industry for years.
WARNING: You should use a moderate grip only. If you squeeze too hard you could cause bruising and or
rupturing of superficial blood vessels on and near the surface of your penis. If after doing the technique you see any
red blotches or dots you used to tight a grip have ruptured some superficial blood vessels and should wait until they
heal (Approximately 24-48 hours) before applying this or any other enlargement technique. You should do this 5-7
days a week for 30 minute each time. Don't squeeze too hard as you could bruise your penis. This techniques has
worked for many men, but it may take up 6 months before you see any noticeable difference and most men will give
up after 4 - 6 weeks. What you are doing is forcing more blood into the corpora cavernosa (spongy tissue of the
penis) and over time they will stretch and grow to allow more and more blood to fill the area, and henceforth you
penis thicker. The technique also over time stretches the tissues of the penis as well as the suspensory ligament,
which will help to lengthen the penis.
The Stretch Technique
The stretch technique is basically what it sounds like. By stretching the penis 6 to 12 times a day you help to
lengthen the suspensory ligament and tissues of the penis which will help to lengthen the penis over time. Dr. Walter
Schlesingser M.D. first made a similar technique popular in his book titled "Penicure, the Manhood Miracle". The
Technique:
1. Your penis should be flaccid to slightly semi-hard.
2. Grip the head of your penis with your thumb and first three fingers, with an over hand grip, the middle finger
should wrap around just below the head of the penis.
3. Gently and slowly stretch you penis as far as it will stretch without any pain or discomfort. Hold for 15-30
seconds.
4. Repeat step 4 several times each session.
You should do this technique several times a day i.e. after urination, a hot bath, a shower, before bed, or any other
occasion that you have access to you penis.
Taoist Exercises
The next couple of exercises are ancient Taoist techniques for giving the penis a more pleasing mushroom shape and
to produce harder erections. Both of these are done with an erection. The first one is optional if you like the shape of
your penis.
Technique #1:
To Reshape the Penis This first technique is designed to give the penis more of a mushroom shape and make the
head larger which is said to heighten pleasure for the female partner during intercourse.
1. Stimulate your penis until you have a very firm erection.
2. Grip the shaft of your penis with an underhand grip.
3. Squeeze firmly (but not hard enough to cause pain or to bruise your penis).
4. Slide you hand up to the head, as if forcing blood into it. It is like a milking motion. You should see the head
expand and darken. Hold for a few seconds, then release. 5. Repeat step 4 for 2-3 minutes. Technique #2: To
Strengthen the Penis and Produce Harder Erections
1. Stimulate your penis until you have a very firm erection.
2. Grip the shaft of your penis with an underhand grip.
3. Squeeze firmly (but not hard enough to cause pain or to bruise your penis). Hold for a few seconds, then release.
Repeat step 3 for 2-3 minutes.
Techniques That Require Added Equipment Hyperemiation or Vacuum Pumping
No doubt you have seen a vacuum pump be sold in the back of a men's magazine or in a sex shop hanging on the
wall and thought to your self "I wonder if it really works?". Maybe you have even bought one and tried it with little
or no success. I am sure that many men have. I bought several and threw them out when they did not work for me!
Vacuum pumps do work for some men, if used correctly and diligently over time. The problem is the lack of
information and instruction that comes with the pump itself. In fact if you use the pump in the wrong way you could
actually injure your penis! I know of many people including myself who have used Hyperemiation and vacuum
pumping to increase the thickness and length of their penises with good results. It seems that an increase in thickness
results much more rapidly than in length. So if you are mostly interested in girth as that is what most women prefer,
then this is the technique that I would apply first. There are a lot of Vacuum Pumps on the market today and some
are just plain junk others are very well made. You should get the best that you can afford the prices range from
$20.00 to $300.00 for an electric pump version, with a good pump usually costing about $75.00. If this is out of your
budget you may opt for one of lesser quality and price. What ever the price, you should get one that has hand pump
with a pressure release valve on it that will allow you to release the vacuum at will. There are some models on the
market that have a hole on the clear plastic chamber that you have to put your finger over for the vacuum to work. I
found it to be almost impossible to pump and cover the hole at the same time; therefor I would avoid this type of
pump altogether. Also you don't want to a pump with a chamber that is too large for you. The chamber should be 1/4
inch to 1/2 inch bigger around that you erect penis, but not big enough for the chamber to cover or go over you
scrotum. What actually happens when you use a vacuum pump is that as you apply the vacuum to your penis, the
outer skin of your penis expands outward toward the walls of the cylinder as this happens the deeper spongy tissue
of the penis (the Corpora Cavernosa and the Corpus Spongeosum) expand and fill with blood and lymph fluid as
they are being stretched by the vacuum pressure. As the process is done over and over again for several months the
spongy caverns expand to a new larger size to accommodate the blood and lymph. That is how the penis becomes
larger.
The Vacuum Pumping Technique:
Things you will need:
1. A quality Vacuum Pump with a pressure release valve.
2. Pumper's Lube or some other water based lubricant, such as Wet, Probe, or Astroglide.
3. A tape measure.
4. A towel to clean up any spilled lube and to wipe off afterward.
The Actual Technique:
1. Now move to a comfortable position, preferably siting up or at a 45-degree angle. Generously lubricate the base
and opening of the pump where you insert your penis.
2.
Lubricate you penis with the water-based lubricant and stimulate your penis until your penis is either semi-erect
or hard. And measure it with the tape measure, both length and girth or circumference. 3. Insert your penis all
the way into the clear chamber and close the pressure valve.
3. Now this is where 90% of all men screw up. You want to create only a moderate vacuum. If you over pump and
create too strong a vacuum you could burst blood vessels or cause lymph blisters on your penis. So you might
be asking, "how do I know what a moderate vacuum is?". Here is a way that I have found to work. First start
pumping slowly until your penis stretches and expands to its limit. The way you know the limit is that 1) it will
feel uncomfortable. 2) Your Penis will not stretch much farther. If your semi-hard when you do this, you will
see your penis stretch, however if you are rock hard you might not even see it stretch.
4. So when you have found your limit and is seems a bit uncomfortable, release some of the pressure from the
release valve, until you are at a pressure that is comfortable, yet you still feel a stretch.
5. Keep continuous a vacuum on for 30 min. After 30mins. you should release the pressure completely, take your
penis out and measure it. If there are not any noticeable gain, you have not pumped long enough.
6. Massage you penis and area around the base gently for a minute, then you may either stop keep pumping for
another 30 minute session. I recommend that for the first month you take it easy and just do 30 minutes a day 57 days a week. After that you might want to pump for a longer duration of 45 minutes - 1 hour or so. I have
heard of men pumping for up to 3 hours. I personally have never gone over 1 hour myself.
The key seems to be a balance of vacuum pressure and time. The longer the better with a moderate pump. The
greater the vacuum pressure the greater the risk of injury and blisters. You will have to find the right balance for
yourself, where you have adequate pressure for a duration of time 30 minutes - 2 hours, that will give you the
greatest gain without any injury. If you do plan to go over an hour which I have never done and don't recommend,
be sure to take 3-5 minute break every 30mins. To allow fresh blood into the penis. Tip: I have found that the
Vacuum Pumping Technique is more effective if the penis is erect during the session. While you will not be able to
maintain an erection through the whole session, I believe that you should start that way, and try to maintain it for as
long as possible. To aid in this I recommend that you view some erotic material during the session, i.e. an erotic
magazine or video. Also if you use the supplement L-Arginine an hour or so before the session you will stay hard
much longer.
I have also have had good results by using the maximum SAFE and COMFORTABLE ( it should not hurt or burn, if
it does the pressure is too great) pressure for a duration of 30-45 minutes while sustaining an erection. It seem to
work on the deeper tissues of the penis more, when you have an erection as opposed to the external skin with out an
erection.
Repeat this technique on a daily basis 5-7 days a week if possible.
Now for the warnings.
WARNING: Use Only A moderate Vacuum Pressure!
1. Do not use too great a vacuum or you could burst blood vessels.
2. If you feel any pain immediately decrease or completely release the vacuum pressure. You do not want to injure
your penis! It's better a small penis, than one that is damaged.
3. In some cases a side effect of pumping and over pumping is that, the opening of the penis gets deformed or
changes shape a bit and when urinating the urine will come out in a spray instead of a stream. If this happens,
stop pumping for (24-48 hours) and see if it goes back to normal. If it does return to the normal state and you
still desire to use pump technique, use a lesser vacuum pressure. If you y still experience the side effect you will
have to determine if you want to continue with the technique altogether. But as I said before this is generally a
result from over pumping with too much vacuum pressure and or pumping too often.
4. After your pumping session examine your penis and see if there are any tiny red dots or red blotches. If you
only see tiny red dots, you are using too great vacuum pressure and have broken tiny superficial blood vessels in
your penis, which is for the most part harmless but overtime could give the penis dark hue over the affected
area. If you find any larger red blotches you should discontinue use of the Hyperemiation treatments and any
other techniques until they completely heal. If there is any severe pain you should seek medical attention.
The Program
I am going to share with you a program for penis development and enlargement that has worked for many men
including my self. The expected results are to gain about an inch both length and circumference over 6-8 months.
Individual results will vary depending on how faithful to the program you are, your body structure, and how
regularly you do the program. The program should be done 5-7 days a week. I think you will also benefit from
taking the supplements discussed earlier in the manual for producing harder erections, because if you are not as hard
as you can get you are not as big as you can get.
The Program:
The following Techniques should be done 5-7 days a week.
The Program contains three parts, two of which can be done at different times of the day or all at the same sitting.
Part 1 1. Do the hot compresses for 5-15 minutes, The closer to 15 the better!
2. Do the Jelq Technique for 30 minutes.
Part 2 1. Do the hot compresses for 5-15 minutes, The closer to 15 the better!
Do the Hyperemiation treatments for 30-60 minutes with a 1 minutes break and massage of the penis at 30 minutes
to allow fresh blood to enter the penis.
Or At One Sitting
1. Do the hot compresses for 5-15 minutes, The closer to 15 the better!
2. Do the Jelq Technique for 30 minutes.
3. Do the Hyperemiation treatments for 30-60 minutes with a 1 minutes break and massage of the penis at 30
minutes to allow fresh blood to enter the penis.
Part 3 1. Do the Taoist Techniques #1 and #2, upon rising in the morning on your morning erection, or any other
time you have a strong erection.
2. Do the Stretch Technique whenever you urinate or any time that you are nude and your penis is flaccid. 10-12
times a day.
Attitude and Belief
Your attitude and belief regarding the techniques presented in this manual are just as important as the actual
techniques themselves. I am not saying that if you don't believe that they won't work at all, but they if they still do
the results wont be a great as if you did believe in them. This is the same principal that applies to patients in
hospitals who should respond to the medicine should recover and don't because they just give up or don't believe that
the treatment will work. Like wise there are those who are given up on and make full recoveries, despite the odds!
They same applies here, if you use these techniques with the attitude, "It won't work for me, I never be able to last
all night long! Or "This is bullshit I am stuck with a 5 1/2 cock forever!" the results will respond accordingly. How
can you expect great success when you are planning for failure! The attitude you need to have is that it will work
and, "I have a BIG COCK!" and "I can last ALL NIGHT LONG!" Say it now! SAY IT OUT LOUD! And believe it.
I am going to share with you the key to success in anything! "What ever it is you want you have to feel as though
you already have it!" Read it Again. "What ever it is you want you have to feel as though you already have it!" What
this means is that if you want a big cock you have to feel as though you cock is already big. If you look down a feel
disappointment that's not going to cut it. You have to feel that you have a great big cock! Say I have a BIG COCK!
Say it until you FEEL IT! In your gut, in your spirit, in your soul, and then you will feel it in your body. These are
called affirmations, but for many years many people have tried using affirmation with little or no results. They were
doing them wrong; they were just saying the words and not feeling them. Some times when you say an affirmation
another part of you gives or says a negative response, that is why the affirmation does not work. You need to deal
acknowledge the response and then do the affirmation again. You have to do this until there is no other response,
except your intent to create the desired result and your affirmation. Here is the technique in step form.
The right way to do affirmations:
1. Define what it is that you want.
2. Have the intent to create it in your life.
3. Say it out loud with the intent of creating it.
4. If you here any mental noise or negative talk or response. Give it a voice and say it out loud as well, get it out if
your system, make it bigger than life, really exaggerate it! When you are at the peak of exaggeration,
immediately commence with step 3 again.
5. When you can State your affirmation without hearing any mental noise or other response and feel as though it is
true, then you know there are working and your life is bound for a change. Visualize Your Goal You should
also visualize your Goal. See your self in your mind's eye, having the size penis that you desire. See how big it
is when you urinate.When you have sex and how pleased your lover is with your size. Don't think of it as
something that is going to happen but as something that has already happened or that always was. What all of
these mental techniques and exercises are doing is that they are opening you up to new possibilities and actually
opening your neural pathway to give you the best results possible. In conclusion We at hope that you will
benefit from the knowledge contained in this manual and would like you to share your success stories with and
let us know of any improvement we could make to our manual. We would also like to hear of any variation on
the techniques that you might have had success with or any new techniques that you may know about that we
did not cover.
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
Date__________ Flaccid Erect Length________ Length________ Girth ________ Girth ________
The Hot Cloth Warm Up
The Hot Cloth Warm Up is extremely important in beginning and ending each
session of your exercise. Just as you would warm up your entire body before
working out, you must do the same for your penis. This allows the blood to get
flowing through the entire penis and also to return to normal after you’re finished
exercising. The portion of the penis that you will be concentrating on is called the
Corpora Cavernosa. The Corpora Cavernosa, along with other tissues within the
penis fill with blood during arousal causing an erection. The penis must be
warmed up before reaching this phase of the program.
Warming up is a crucial part in the routine. Be sure to warm up properly before
beginning the exercises within this program.
To begin, shake your penis gently. Make sure that it is fairly flexible. Rub the
shaft a few times to get the blood flowing and begin to stroke yourself to a semierect position. Soak a hand towel in hot water until it is completely wet and warm
to the touch. Gently wrap the towel around the entire penis and the testicles.
Even though it may be a little uncomfortable initially, resist the urge to pull the
towel away. The warmth will quickly become more comfortable. You will come to
enjoy this part of the work out and cool down after a few sessions. You should
leave the towel on the entire area for 2 minutes. Re-soak the towel and warm it
again to the same temperature as before. Once again, wrap the entire penis and
testicles with the cloth and warm it for another 2 minutes. Repeat this process
another 3 times. This will ensure proper warm up for the penis by unrestraining
the tissues and cells within the Corpora Cavernosa. Warming up will allow for the
penis to get the maximum benefits out of the exercises following and ensure that
you will have minimum bruising.
You may also use other methods to warm up your penis. A hot tub or Jacuzzi is a
great way to get the blood flowing through the penis. Be sure to turn up the heat
a bit for optimum performance. Don’t stay in too long; 7-10 minutes should be
plenty. Be sure that you also gently massage the penis to assist the blood flow.
You may also sit in your home bathtub if that is more comfortable. Once again,
be sure to heat up the water to above 100 degrees and only stay in for 7-10
minutes. Once you are finished warming up, you are ready for the exercises!
The Jelq Method
The Jelq method has been used for hundred for years to enlarge the penis. Many
men who have followed the Jelq method have enlarged their penis over 10
inches in length and 7 inches in circumference. These men started using this
method in their early teens and continued into adulthood. Once into manhood,
they reduced the session to once a week. Sizes compared to these are quite
large and come with years and years or religious performance.
www.menshealthprogram.net
How the Jelq Method Works
The main function of this exercise is to lengthen and thicken the penis. The
Corpora Cavernosa is filled with more
blood than it is generally used to,
allowing the cells within the shaft to
grow larger and larger. This process
tears down the fibers of the muscles
during the exercise and as you rest, it
rebuild itself, growing larger and
stronger. This also allows the tissues
in the penis to hold more blood, which
in turn will amazingly increase the
size of the entire penis. However, this
does not happen over night, but
rather with months and months of the
routine. After 5 weeks, you should
notice a small difference in the size
and strength of your penis. After 6
months, you will notice remarkable
changes in your penis. It will be much
more controllable, larger in size and
girth, and will give you the inspiration
to continue the program for years to
come. Within a year, you will see a
gain of 3+ inches and your erections
will be much, much harder. Your penis will also hang lower and be more
attractive. Remember that gains come with time and hard work on your part. The
exercises will not work on their own. You must do your part as well. What man
would not want to have a gain of 3+ inches within the first year of exercising?
How to do the Jelq Method
Always remember to warm up with the Hot Cloth Warm Up before beginning the
Jelq Method. This should be performed every day, if time allows, for maximum
benefits. This procedure is a lot like milking a cow. You must begin with a semierect penis. Start by grasping the base of the penis with your forefinger and
thumb, making an "O" with the two fingers. By doing this, the blood circulation is
being cut off, causing the cells to hold more blood. Begin to move your hand
forward, causing the blood to move into the shaft of the penis and filling those
cells with even more blood than they are used to holding. As your right hand
reaches the head of the penis, grasp the base again, only this time with the left
hand. Use the same technique as you did with the right hand. Continue this
technique for 20-25 minutes. Just like working any other part of your body, you
are breaking down the muscle and rebuilding it, allowing it to grow.
During the first 2 weeks, you may experience small red bumps or slight bruising
at the head of the penis. This is quite normal: don’t be alarmed. They will go
away after the penis is more conditioned for the exercise. Start off at a slower
pace and work up to a faster stroke to avoid bruising.
www.menshealthprogram.net
Look at the photos above. They visually display the exercise. Make sure that you
are working with a semi-erect penis, or you will not see the benefits. It is
important to push as much blood as possible into the head of the penis to cause
the cells to fill more than normal and build size. You will notice that the entire
penis is a very dark red color, sometimes almost purple. This is normal because
of all of the blood being pushed forward.
Frequently asked Questions About the Jelq Method
Q: How much pressure is enough during Jelqing?
A: While you should not have a painful experience at any time during the
exercise, you should feel some pressure. Different man can tolerate more than
others, so it’s not the same for every man. On a scale of 1 to 10, 1 being no
pressure and 10 being intolerable, you feel something in-between 5 and 7. Not
too much, but not too little.
Q: What should I do if I lose my erection during the exercise?
A: Many men find it easier to maintain an erection with the use of adult material
of some kind. This is perfectly okay. If you do lose your erection, do whatever
you need to in order to bring yourself back to a semi-erect position. Remember,
you will not get as mush out of the exercise without a semi-erect penis.
Q: Is it normal to get a lot of loose skin while Jelqing?
A: Some men have an excess of skin near the base of the penis and around the
testicle region. This is okay and can be worked around. Instead of using both
hands to Jelq, use one hand to hold back the excess skin and continue to Jelq
with one hand. Switch hands every 25 or so, to keep the balance.
Q: What determines a "partial" erection?
A: The exercise works the best with a partial erection. This means that the penis
is filled with about 3/4 of the blood as during a "hard" erection. This allows the
cells within the penis to fill with more blood then normal, breaking them apart and
rebuilding them. The shaft of the penis should be a deep red to a dark purple in
color, and you should not feel any pain. A slight amount of pressure is normal,
but not too much to cause pain.
Q: Is there a certain time of the day that you will see maximum results? Can you
do this before or after sex?
www.menshealthprogram.net
A: There is no certain time of the day that you will experience more benefits.
Whenever you have the most time is the most beneficial to you. You may
perform this exercise before or after sex, it makes no difference.
To Obtain the Maximum Benefits
Week One: If this is the first time doing the exercise; begin with 250-300 Jelqs
per day. One complete Jelq is one complete stroke from the base of the penis to
the head. Do the Jelqs in combination with the PC Flexes. Do 100-125 PC
Flexes per day. Refer to the PC Flex section for instructions on how to perform
this exercise.
Week Two: This week you should use a more intense stroke. Jelq for 10-15
minutes without a break. Every movement should be smooth and painless. Stop
immediately if you should sense any pain. Don’t forget to do the Hot Cloth Warm
Up before beginning the exercise session. This will allow for maximum
performance. Do this in combination with the PC Flexes as well. You should do
200-225. Also, don’t forget to do the Hot Cloth Warm Up as a cool down when
finished.
Week Three: This week will be more vigorous than the last two. By now, you
should be doing 30 minutes of Jelqing. Don’t forget that this procedure takes time
and does not happen overnight. You must be patient and persistent. You should
also do 300-325 PC Flexes in combination with the Jelqing. Again, be sure that
you warm up and cool down with the Hot Cloth Warm Up to get the blood
circulating and back to normal.
The Advanced Jelq should not be performed until well into the program. The
recommended time is a minimum of 2 1/2 months, to unsure proper strength. If
you begin this advanced step too soon, you will only injure yourself, which will
delay improvements.
The Advanced Jelq
Begin in the same manner as you did with the normal Jelq technique. Only this
time, apply some type of lubricant. Many men use baby oil or Vaseline. Do this
for 15-20 minutes. Also, remember to start off with the Hot Cloth Warm Up. You
are now ready for the Advanced Jelq session.
The Advanced Jelq is preformed in the same manner as the normal Jelq, only it
should last longer, between 3-5 second on each one. After every 15 strokes, you
should perform a PC Flex. This Procedure should be performed for 30 minutes.
Since this exercise is more advanced, it is only need about 3-5 times each week.
This procedure forces even more blood through the Corpora Cavernosa than the
regular Jelqing technique, which enlarges the penis even more. Remember that
this exercise is exactly the same as normal, but you go slower down the shaft
and perform a PC Flex after every 15 strokes. Also, don’t forget to cool down with
the Hot Cloth Warm Up to return the blood circulation to normal.
www.menshealthprogram.net
The PC Flex Exercise
PC Exercise Overview
The pubococcygeus muscle, better known as the PC muscle, is the target of this
exercise. Refer to the photo to better find where it is located on your body. This is
the muscle that controls your ejaculate. Every man should use so some kind of
exercise to strengthen his PC muscle. This will allow you to last longer in bed
and heighten your sexual experiences. If you do not perform the Jelq Method,
just doing this exercise alone will help you control and have stronger
ejaculations.
What the Exercise Does
Exercising the PC muscle can lessen the chances of impotence, premature
ejaculation, weak erections and poor ejaculations. This muscle controls how and
when you ejaculate. Strengthening this muscle will allow you better control over
the passageway to your ejaculatory duct, increase your stamina, and lessen the
problems that come with aging.
There are many benefits for exercising your PC muscle. These exercises are
extremely easy to do. Unlike the Jelq method, there is no other technique to
learn. These exercises take almost no effort and very little time. These can also
be done practically anywhere, since it does not involve touching yourself or
taking off your clothing.
How to do the Exercise
This muscle is very easy to find. Refer to the photo if needed. You have known
what this muscle is since you were first potty
trained. It is the muscle that you use to stop
urinating. You probably just didn’t know that this
muscle also controls your ejaculations. This is
also the muscle that allows you to move your
penis when it is erect. Regular exercise of the PC
muscle has many benefits. It allows you to control
when you will ejaculate, allows for harder and
stronger erections, and also helps you well into
later life by avoiding Incontinence, or the ability to
control one’s bodily fluids.
To begin the exercise, first locate the muscle if
you have not already done so. Contract and
retract the muscle quickly. Do 15-20. If you
cannot gain control at first, imagine that you are
urinating and must stop midstream. Do this 15 times if possible. On the last
contraction, hold it for 10 seconds. If you cannot hold it that long, it’s okay. Most
men cannot hold it for longer than 3 seconds at first. Eventually, you will be able
to hold the contraction for as long as you would like. As you become better at this
exercise, you will gain more control over your ejaculations and be able to hold off
longer.
www.menshealthprogram.net
Refer to the photo below. This man has extreme control over his PC muscle.
Notice how he moves his penis without the help of anything but the PC. After a
few months of practice, you too should be able to do this.
The PC muscle does not have to be erect to perform these exercises. There are
a variety of ways to work this muscle. Listed below are a few ways to exercise
the PC muscle. Not all of them may suit your needs. We recommend that you try
out all of them and do the ones that you feel comfortable with.
PC Holds
This is a simple exercise that we have already explained. Begin with a few sets
of 40 or so and build your stamina up to sets of 120 or more. Do as many as you
can at first. Some men work up to sets of 500 or more. A good rule of thumb is to
work up to about 250-400 PC Holds for the rest of your life. This exercise is so
great because no one knows that your are doing it. You could be at the office or
at home watching TV and no one would know.
PC Squeeze And Hold
Once you are warmed up, do about 10 normal flexes. On the 10th flex, hold it for
a count of 25 seconds. Rest for a minute. Repeat the entire exercise 5 more
times. This exercise will give you a harder erection and the stamina that you
have always wanted. Don’t forget that this exercise depends on you, be sure to
stay with it and don’t give up. There really is no way to do this exercise wrong, as
long as you can feel the muscle working. This exercise will help you to better
control your ejaculations, allowing you to last longer than you could have ever
imagined!
PC Increments
This version is very simple. Begin by tightening your muscle a little and holding it,
tighten it a little more, and hold it again. Finally, tighten it all that you can and
hold for 10 seconds. Release in the opposite way. Release only a small amount
and hold it, release again and hold it. Finally, release the entire muscle. This will
help you extremely in controlling your ejaculations. For a man to hold off an
ejaculation all he has to do is squeeze his PC muscle and he can last longer.
This exercise gives you that power!
PC Exhauster
This exercise is by far the most demanding of all the PC Flexes. You should try
out all of the other variations before attempting this one. Although this exercise is
very rigorous and demands a lot from you, you will get the most out of this
exercise. However, this is the most stressful, so you must be determined to
complete it. The first time you attempt this will be hard, but keep with it.
You may feel more comfortable sitting in a chair for this exercise. You need to
find a place that you feel comfortable remaining for a few moments. Warm up
your PC with 30-50 slow, strong contractions. When finished, grasp your penis in
a tight clench and hold it for 10 seconds. Follow this with 150 controlled PC
Flexes. When the going gets hard use your visualization and breathing
techniques to help you through the workout.
www.menshealthprogram.net
On your last PC Flex, hold it for as long as possible. Try for about a minute or so. Allow yourself
to take a brief 3-minute break. Finish with 40 more strong PC Flexes. If you can’t do the full 40,
try and do as many as possible. Make sure that they are all strong and controlled, even when you
begin to fatigue.
You should be very fatigued now, and there should be an enormous amount of
blood in your PC muscle region. You’ll feel the burn just like after a good workout
of any other body part. This exercise is by far the most difficult, but gives the
most benefits. If you continue doing this routine for a few months, you will see a
tremendous gain.
This exercise is so great because you can do it basically anywhere. No one will
be able to tell that you are increasing the control of your ejaculations. If you fail to
do any of the exercises, don’t let it be this one. The PC Flexes give you so much.
They increase stamina, allow you to erect at any time, and most importantly,
allow you to have total control of your erections. This should be the exercise that
you perform the most.
Remember, no one can tell that you are exercising your PC. Take advantage of
the time you spend in the car, at work, or even watching the television.
The Length Stretch Exercise
The Length Stretch exercise is an alternative to the Jelq exercise, but should be
used in conjunction with the Jelq for the best results. Using the Length Stretch
exercise alone will produce results. If the Jelq exercise is not working for you, try
using the Length Stretch in-between the Jelqing.
How it Works
The Length Stretch exercise does just what it says, it lengthens the size of your
penis. This technique will do absolutely nothing for improving the girth of your
penis so it is recommended that you also use the Jelq exercise at the same time
as the Length Stretch. As with the Jelq, the only tool you will need to perform this
exercise is your hand. For optimal results, be sure to warm up with the Hot Cloth
Warm Up and use the PC Exercises, the Jelq Exercises, and also the Length
Stretch Technique. If you follow all of these basic procedures, you will see
unbelievable results in just a few weeks.
This exercise works much like the Jelq Technique in terms of what goes on
inside of the penis. Understanding what your penis is going through during these
exercises will help you to perform them better and receive the most benefits.
When performing the Length Stretch exercise, the Corpora Cavernosa, or the
shaft of the penis is filled with blood. The pressure of the exercise allows for
more blood than normal to enter into the cells in the Corpora Cavernosa,
expanding the cells and allowing for more blood to enter. This technique will
allow for the length of the penis to greatly increase. All of these exercises are
completely safe and cannot harm you in any way. You must always remember to
warm up by using the Hot Cloth Warm Up to get the blood flowing through the
penis and prohibit injury. The penis is by far the easiest of all muscles to enlarge,
simply because the purpose of the penis is to enlarge during erections. If the
exercises are performed correctly and routinely, the cells will eventually double in
size, allowing for more blood to be present and the length to extend. You will see
results immediately with either a limp or a hard penis.
www.menshealthprogram.net
How To Do It
As with any exercise, be sure to warm up first with the Hot Cloth Warm Up
technique. Unlike the Jelq
technique, you must perform
the Length Stretch with a
flaccid, or limp penis. If you do
become erect during the
exercise, stop for a moment
and let the erection subside.
This must be performed while
limp because it is nearly
impossible to stretch an erect
penis.
Be sure the penis is limp and
gently grab hold of the head of the penis. Do so with little pressure, just enough
to avoid letting it slip away. Gently, but firmly, pull the penis out in front of you.
You should feel the stretch in the middle and
the base of the penis. This exercise should not
be painful by any means. A feeling of pressure
is normal, but once you feel pain, let go and
start over. Remain in the stretch position for 15
seconds. Repeat the entire process 5 more
times. Once finished, gently massage the entire
penis to restore circulation throughout the
penis. You may perform this exercise by
stretching both up and down. Refer to the
photo’s on this page.
The second part of this technique will stretch
the sides of the penis. Begin by grasping the
head of the penis as you did before. Gently pull
the head of the penis to the left. You should feel
a stretch in the base of the penis on the right
side. Continue to hold this position for 15
seconds. Repeat the entire exercise 5 more
times. Now, stretch the right side in the same
manner as the left. Once again, you will feel a
stretch in the base of the left side of the penis.
Hold the position of 15 seconds, and repeat 5
more times. Once you have completed the
entire exercise, you should feel a great deal
stretched. A good time to perform the Jelq
technique is once you’ve stretched with the
Length Stretch. Remember to combine the two
exercises for the best possible results. Be sure
to stay with this technique for 2 months before
moving on to the Advanced Length Stretch.
This will ensure that the penis has worked out
enough to avoid injury in a more advanced
exercise.
The photos on this page show that you should
always perform this exercise with a limp penis.
www.menshealthprogram.net
Be sure to grip the penis at the head before stretching. You will not need any
kind of lubrication for this exercise because there is no friction. You will want the
penis as dry as possible. If you are having trouble gripping the penis, you might
try using some talcum or baby powder to allow for a firmer grip.
Advanced Length Stretching
As with all exercises, be sure to always warm up with the Hot Cloth Warm Up for
about 10 minutes to get the blood circulating throughout the penis and avoid
injury. This will also help to loosen the tissues within the penis and allow for
maximum results. If you had trouble keeping hold of the head of the penis in the
regular Length Stretch exercise, be sure to use talcum or baby powder to allow a
better grip. Gently stretch the penis to the right, left, up, and down to warm up the
penis. Gently massage the entire penis and it’s head to loosen the tissues and
the blood. As with the regular Length Stretch, make sure that the penis is flaccid
while performing this exercise. You may want to take a minute of so to rest
before beginning to ensure for a completely limp penis. Be sure that you know
what your limits are when performing this exercise. If you experience any
discomfort, bruising, or abnormal functions, you may want to take the exercises a
little slower or resort back to the regular Length Stretch exercise. Also, be sure to
stay with the regular Length Stretch exercise for at least 2 months before moving
on to this exercise.
Begin as before by grasping the head of the penis with a firm hold. Pull your
penis directly in front of you. You should not feel any pain, but only a stretching
within the middle and at the base of the penis. Hold this position for 15 seconds,
and repeat it again 5 times. This is the same as the beginning of the regular
Length Stretch exercise. Gently massage the entire penis and it’s head to restore
circulation to the head.
Be sure that your penis is still limp before continuing. Grasp the head of the penis
again, as before. Use enough pressure to retain a firm hold. Pull the penis to the
far left. Pull as far as possible before feeling pain. You may feel a stretch in the
right middle and base of the penis. Hold this position for 15 seconds. Repeat this
procedure 5 more times. You will now stretch to the right, just as before. Grasp
the head of the penis firmly and pull to the right. You may feel a stretch in the left
middle and base of the penis. Hold this position for 15 seconds. Repeat the
exercise 5 more times. Now gently pull the penis head out directly in front of you.
Hold this position while you rotate your penis in a clocklike motion. Do not twist
the penis, but rather rotate it in a circular motion. Continue to rotate the penis 40
times, with a rotation being a full circular motion. Continue this exercise 5 more
times. If you tire, take a small break. Be sure to concentrate on your breathing
and imagine the length of your penis growing. Take a small break and then
continue with the left. Grasp the penis as before and move in a circular motion to
the left. Continue with 40 rotations. Repeat this 5 more times. This exercise may
get a bit tiresome, so take a small break in between sets. This is also a great
time to continue with the Jelq Technique. By now, you should be Jelqing for
about 30 minutes each day. Be sure to combine all of the exercises for maximum
results. If you continue with all of the exercises, your erections will be harder and
your ejaculations more controlled. You will also see an increase of 2-3 inches in
the length of your penis!
The Testicle Massage
www.menshealthprogram.net
Many men look over the testicles and concentrate only on the penis. It is wise to
allow some time for the massaging of the scrotum. Although the appearance of
the testicles is not as important as that of the penis, the health of the testicles is
extremely important. The health of the testicles allow for harder erections,
increased ejaculations, and an increase in your sex drive. The health of the
testicles will keep your penis in greater overall health and performance.
How To Do the Exercise
Start off as you do all exercises, with the Hot Cloth Warm Up. Wrap the entire
package for 5 minutes. This will loosen the scrotum and make it more pliable.
Coat the scrotum with a lubricant or baby oil, whichever is of your liking.
Massage the entire scrotum for 5 minutes. Try to work around the testicles. You
should not apply enough pressure to hurt yourself. Pain will only defer you from
the exercise. Once finished, grab the testicles and move them around. Gently
pull them around the scrotum to different positions. Continue this for 2 minutes or
so. Finish by gently massaging the entire scrotum and it’s testicles. Continue for
1-2 minutes to return the circulation to normal. By doing this massaging
technique, you will assist yourself in improving sperm count, increasing blood
flow, and maintaining the overall well being of the testicles and the scrotum. You
may want to perform this exercise before going to bed at night, especially if trying
to have a baby. This exercise will greatly increase the sperm count and allow for
an easier conception. You can do this exercise as much as you would like, it will
only help maintaining the health of the penis.
Visualize Your Goal
Visualization is a technique that will assist you in obtaining your goal faster than
you thought you could. This method will not only assist you in the exercises, but
also in your everyday life. Many athletes use visualization to aid them in reaching
their specific goals. Reaching the inner self will also allow you to be more
determined to complete the exercises each day and will in turn allow you to see
greater results in less time.
Different variations of visualization are more efficient for some then others. You
may want to begin by simply closing your eyes and envisioning the perfect penis.
While you are performing the exercises, close your eyes and picture the blood
moving through the shaft of your penis. Imagine the cells becoming full of blood
and expanding. Believe that your penis is getting larger with every exercise. This
routine may be difficult to get used to at first, but once you become more
comfortable, you will be able to visualize with much more power. In a short
amount of time, you will notice that the results are greater when you combine the
exercises with visualization and imagery.
Another key technique that should always be used is breathing. You should try to
time your breathing and your exercises together. This will allow for you to clear
your mind, help with blood flow, and bring more energy to your muscles.
Breathing control is also very important in controlling your ejaculations. During a
sexual act, you must be able to tighten your PC muscle if you feel the need to
stop an ejaculation. If you are already practicing breathing control, this situation
will be much easier for you to control.
A great way to gain control of your breathing is to follow this routine: Begin by
finding a quite place where you will not be bothered. Clear all thoughts from your
www.menshealthprogram.net
mind. Allow everything to slip away. Do not think about anything. Slowly take a
deep breath in through your nose. Fill your lungs full of air. Hold this for a few
seconds. Slowly breath out through your mouth. Don’t let it all out too quickly.
Repeat this technique for 10 minutes. Breathing is important to help with many
aspects of your life. It allows you to perform better in sexual situations, control
anger, and allow you to relax. If used in combination with visualization, you will
notice more of a gain in less time.
Helpful Tips
When choosing a lubrication product, you may use whatever kind you prefer. We
have found that baby oil and Vaseline work the best. Lubrication is important
when you are performing the same exercise for a long amount of time.
Lubrication prevents chaffing and becoming raw, so it is important to lube up well
before beginning. We recommend that you do not use soap or any other product
that evaporates quickly. These will not harm you. However, you may find yourself
re-applying often.
Some bruising is normal at first. You may want to take a few days off to allow
your penis to heal. During this time, you may want to continue with the PC
Flexes. These exercises will not cause any more bruising and you can do them
anywhere. Start all of the exercises again once the bruising is gone.
Some men experience small red spots, blood spots, or bruising from performing
the Jelq technique. This is completely normal and will go away within a few days.
You may want to take a few days off to allow your penis to fully heal before
resuming the exercise. You should be concerned if your penis is painful to the
touch or if the spots do not go away within a week. Doing the proper warm up
with the Hot Cloth Warm Up will reduce the chances of bruising or getting red
spots. It is extremely important to warm up and cool down properly.
Just like working any other part of the body, keep in mind that you cannot do the
same exercise every day and expect to see maximum results. We recommend
that you try out all of the exercises that we describe and choose a few that you
like the most. After about a month of performing the exercises, you should be
starting to add some of your own techniques, which is fine. We recommend that
you religiously participate in the program for at least 2 months before beginning
the more advanced techniques.
Visualization and breathing techniques can make it easier to obtain the penis of
your dreams. Visualization will allow you to imagine your penis enlarging while
you perform the exercises, which will make you more determined to continue with
the routine. Breathing will allow more oxygen to reach the muscle tissue, which
will supply you with more energy. This technique will also allow you to relax more
and concentrate only on the exercises.
The PC muscle is the most important muscle to exercise to improve ejaculatory
control. Development of this muscle will enable you to control exactly when you
want to ejaculate. You will have no problem lasting hours in bed with your
partner. The exercises are even better because they can be done anywhere. No
one will ever know that you are strengthening your PC muscle.
Many men have a problem remaining flaccid while doing the exercises.
Remember that you must stay completely flaccid during the Length Stretch and
www.menshealthprogram.net
only partially erect during the Jelq technique. If you become fully erect, take a
short break until the erection subsides.
Performing one exercise after another will produce results faster and greater than
only doing one exercise each day. We recommend that you do the Length
Stretch exercise, followed by the Jelq method. This routine will give you
impressive results after only a few weeks!
Taking a few days off each week will not hurt your workout. In fact, we
recommend that you take 1 or 2 days off each week, but nothing more than that.
The time off will allow your penis to rebuild itself. Remember that the success of
the program depends solely upon you and how dedicated you are to the routine.
Even if you don’t see that 3-inch gain that you are looking for within 1 month,
don’t get frustrated. Stick with the routine. We guarantee that you will see
results!!
ExtremePenis.com Beginners Guide
When just beginning this program, you must be extremely careful while
performing the exercises. If you do not follow the instructions precisely, you put
yourself at risk of injury. The following is a complete schedule for the beginner. It
is advised that all beginners start out with this routine in order to achieve the
greatest results.
We advise that you read through this entire program completely before beginning
any of the exercises. That way, you will better understand what you are doing,
keep yourself from getting injured, and feel more comfortable with the program.
Be sure not to overlook anything, and follow all of the instructions carefully.
Be sure to start out all of your exercises with the Hot Cloth Warm Up.
WEEK 1: Start out slowly. We recommend 325 Jelqs per day. Follow the Jelqs
with 100 PC Flexes. You may also do these throughout the day, however, you
will see greater results if you do them after the Jelq technique. Always finish your
workouts with a cool down, the Hot Cloth Warm Up. This is a great way to not
only warm up your penis, but also to return the blood circulation to normal. You
may also do the Length Stretch exercise if you would like. Many men find it too
difficult to do in the first week. You should do what you feel comfortable.
WEEK 2: Always warm up first, with the Hot Cloth Warm Up. This week you
should be ready for a continuous 10-12 minutes of Jelqing. It is important not to
stop during the 10-12 minutes. Follow with 225 PC Flexes. Once again, you may
do these at another time, but for the best results should be completed after the
Jelqing. By now, you should also be ready for the Length Stretch exercise.
Remember to always cool down when you are finished.
WEEK 3: By now, you should be into a routine of exercising your penis. This
week is tough, but high in results. Begin by doing the Hot Cloth Warm Up. You
should now be able to Jelq for a continuous 30 minutes. Remember to always
Jelq with a semi-erect penis for the best results. You may want to follow this with
a Hot Cloth to loosen up the blood and tissues in the penis from such a long
workout. Follow this with 300 PC Flexes. Week 3 is tough, but determination will
get you through it. If you stay with this program, you will see results soon.
www.menshealthprogram.net
You should stay with the week 3 program for 5 more weeks. After you’ve finished
those, you will have a total of 2 months complete. By now, you should be
developing your own style of exercising, which is great. You can now try different,
more advanced variations of the exercises. You still should not push yourself. Do
what you feel comfortable with. If you feel that you are still struggling with the
week 3 program, do not move on to the advanced techniques yet. Stay with the
week 3 program until you are strong enough to move on. Some men stay on that
program for up to 7 months and see extensive results!
Workout Chart
It is important to accurately measure your penis before beginning the program.
This will allow you to keep track of your progress. Be sure to measure exactly.
Do not round up. This chart will be useful in tracking your weekly gains. We
suggest that you measure your penis only once a week. Although you may see
daily gains, measuring only once a week will allow you to see more of a gain and
keep you from becoming discouraged. As the chart shows, you should measure
your penis when it is both erect and flaccid. Be sure to also measure the girth in
a flaccid state and an erect state. Simply print out this chart and use it each
week!!
Example chart:
Week Number Length Erect Length Flaccid Girth Erect
1
5 inches
3.5 inches
4.3 inches
2
5.3 inches
3.6 inches
4.4 inches
3
5.5 inches
3.8 inches
4.5 inches
Girth Flaccid
3.8 inches
4 inches
4 inches
Foreskin Restoration
Some men may want to restore their foreskin for one reason or another. Most
men did not have the chance to have a say in whether they got circumcised or
not because this procedure is generally done at a very young age. The purpose
of the foreskin is to protect the penis head and keep it moist. We generally do not
see much need for foreskin now, although some men enjoy having it. Generally,
men prefer to be circumcised, but there is no problem with having foreskin. Thus,
in our quest to provide the most information to our members, we have included
this in the manual.
Restoring the foreskin generally takes between 2-4 months and is an easy task.
This does, however, require daily work. Unlike the Jelq technique, be sure not to
use any lubrication. Begin with a hard erection. Performing PC Flexes may help
you in achieving a harder erection. Start by grasping the base of your penis with
one hand. Push your hand toward the head of your penis, pushing the thin skin
around and over the head of your penis. When you can feel a good stretch, hold
it there until you become limp. Get another erection and repeat the exercise
again. For the best results, do the exercises for 10-15 minutes each day. After a
few weeks, you should be able to pull the skin well past the head of your penis.
Keep this up and you will soon have a new foreskin.
Average Penis Sizes
www.menshealthprogram.net
It is important to know how to measure your penis properly. Below are a tips on
measuring and charts that show the average range. Remember that average is a
very loose term and can mean a variety of measurements. It makes no difference
if you fall above or below these measurements.
Length:
Flaccid: 3 - 4.5 inches (7.6 - 11.4 cm)
Erect: 5 - 6 inches (12.7 - 15.25 cm)
Girth:
Erect: 4.5 - 5.5 inches (11.4 - 14 cm) at mid shaft
Measuring Your Penis
Before beginning the program, measure your penis and chart the results. This
will enable you to better see the success of the exercises. Don’t round up.
Measure precisely. This will only be to your benefit.
Erect Length
Stand and hold your erect penis horizontally. Press a ruler against your pubic
bone and measure to the very tip of the head of your penis.
Another Way To Measure Erect Length
Stand with your knees locked. Begin by grasping your penis from the bottom, just
behind the head of your penis and pull it out as far as you can. Press the ruler
against your pubic bone and measure on the top of the penis. You can change
the angle, move your pelvis, or try other variations that allow you to get the same
result as your erect length. Once you become accustomed to this technique, you
may find it easier and more convenient.
Erect Girth
Girth is the circumference or the distance around your penis. To measure girth
properly, always measure an erect penis mid-shaft.
Flaccid Girth
When the penis is flaccid, it will be at a different girth at various times. If you have
just completed a strenuous exercise, it may be extremely small. However, if you
need to urinate, it may be fairly large. Be sure to take many measurements at
different times to get the best results.
Visual Comparisons
www.menshealthprogram.net
Some men find visually comparing their penis to an object helpful. Try to use
something that will be around in a few months, like a paper towel roll or a
deodorant container. Stand in front of a mirror and compare by all angles. You
will be able to compare your results in the months to come and have a better
idea of where you are at.
Measuring Before Beginning the Program
You should measure and chart all of you results before beginning the program.
Be sure to measure lengthwise as well as girth wise to get accurate
measurements once you begin to see results. It’s a good idea to use the chart
that we have included in your weekly measurements, that way you can see your
accomplishments.
How to Have a Better Orgasm
This section on Male Orgasm is for men of all types. It is here solely to help you
understand more about how your body works, specifically the male reproductive
system leading up to orgasm. It's our hope that you learn something from this
article, about yourself as well as your body.
Premature Ejaculation:
What exactly is premature ejaculation?
Ejaculation that occurs prior to when a man wishes or too quickly during
intercourse to satisfy the partner.
When most males ejaculate they tend to quickly lose a usable erection for the
simple reason that their discharge has temporarily released a state of elevated
sexual tension.
What are the causes of premature ejaculation?
It seems logical that our prehistoric male ancestors were all rapid ejaculators.
The Homo Erectus who could couple quickly with his mate and rapidly reach
ejaculation was then free to deal with enemy tribesman and predatory sabretoothed tigers. The slowpoke got clubbed or eaten. Therefore, only rapid
ejaculators survived long enough to sire descendants. Thus, if speed of
ejaculation were hereditary, we all should have fast ejaculatory reflexes.
Obviously, the above theory cannot be proven; however, it does contain an
element of truth. It is probably "natural" for healthy males to ejaculate quickly.
Lasting longer serves no genetic function that we know of.
Lasting is a learned behavior, like learning to dance. It can prolong and intensify
pleasure for a man. Also, many women like to experience orgasm - or have been
socially conditioned to enjoy orgasm - when the erect penis is inside them. To
reach orgasm this way often requires periods of more or less continuous
stimulation by the penis.
www.menshealthprogram.net
Premature ejaculation is sometimes also caused or aggravated psychological
factors such as guilt, fear, and performance anxiety.
The first thing a male must hold in mind is that good sex is unhurried sex. The
longer he spends in foreplay prior to his first orgasm, the stronger and more
enjoyable that first orgasm will be. The compacting of blood in the sex organs
builds slowly, inflating the tissues and sensitizing the millions of nerve endings in
and around the genitals.
Think of an orgasm like a balloon: the longer you blow air into it, the bigger
it gets and the louder the bang when it pops.
Orgasm consists of two stages. One begins with the prostate gland, which
encircles the urethra like a tiny donut above the base of the penis, contracts and
releases its fluids, along with the contents of the seminal vesicle, into the urethra.
To most males this feels like you are going to start a good sneeze, but it's too
late to stop. Stage two is similar to the sneeze itself. The pelvic muscle contracts
strongly around the bulb, forcing the fluid out under considerable pressure.
Orgasm is what a man feels when all this is happening. He has probably learned
for himself that it is possible to ejaculate without having an orgasm, but he may
not yet realize that he can also have an orgasm without ejaculating. That's
exactly what you want to learn to do.
The average male in his twenties takes less than three minutes from the time of
insertion till he comes. This cheats him of a lot of fun and satisfaction and doubly
cheats the unfortunate female he prematurely has an orgasm into.
How do I prevent premature ejaculation from happening?
The most common treatment of premature ejaculation is to become more familiar
with the feelings and sensations surrounding the time leading up to ejaculation.
By learning to become more familiar with these sensations, you can slowly learn
how to predict when the upcoming ejaculation will occur and gain more control
over them. This is known as your point of no return.
If you want to be able to enjoy long periods of intense pleasure without
ejaculation, you need to discover your point of no return. Masturbate and
concentrate on you feelings. There is a point at which you will not be able to
control your ejaculation anymore. At that point, as hard as you try, you cannot
stop yourself from ejaculating. You will have to ejaculate because ejaculation is a
reflex: your brain sends messages through your spinal cord to your sex organs
and orders ejaculation.
Once you have successfully discovered your point of no return do not let your
arousal reach this point. You can either change your position or stop moving.
Other techniques you may consider are the "stop and start" and the
"squeeze" methods.
The "stop and start" method. When, during thrusting, you feel yourself getting
closer, cease all movement and press the pubic bone (under your pubic hair)
against your mate's pubic bone, thus pushing your penis in all the way. Then
both stop moving. (Tell her, "Resting time, love.") When the urgency to ejaculate
subsides, start thrusting again. Do this several times in a row. It can also be
practiced solo, using your hand instead of a vagina. A variation of this technique
is to make several voluntary twitching movements of the penis while you are
www.menshealthprogram.net
resting. This can be done by rapidly flexing and relaxing the muscles that control
the flow of urine. Try to identify this muscle contraction next time that you urinate.
This muscle is known as the PC muscle and is described clearly in the MultipleOrgasm section below.
The "squeeze technique" method. This method, which has been proven highly
successful in training men to last longer described in a book by Dr. Herbert E.
Vendervoort and Rev. Ted Mcilvenna. This technique can also be practiced
alone during masturbation.
One stimulates himself until he has had a firm erection for a while, squeezes, and
repeats the process several times. After several squeezes, one should have
much more intense ejaculation than usual.
During the no-intercourse period, the couple should explore one another
sensually, caressing one another's bodies with hands and mouth or by any other
means, short of intercourse, that are pleasurable to both. If the man's penis
becomes erect while his mate is caressing it, she can, at any time that feels right
to her, apply the squeeze to his penis. Preferably this should take place before
the man feels himself on the verge of ejaculating. IF your partner does the
squeeze several times at their discretion, it can become part of their lovemaking
technique.
Multiple Orgasms:
The vast majority of men do not reach sexual maturity with an ability to enjoy
multiple climaxes. This unusual ability is a talent that must be developed.
Dr. William E. Hartman, one of the nation's most respected sex researchers said
"The control of the pubococcygeus (PC) muscle is probably the most simple and
the most direct answer to a man becoming multiply orgasmic."
The PC is the largest of the muscles in the pelvis. It gets its weird name from the
fact that it stretches from the pubic bone in front to the coccyx or tailbone in back.
In most men it is a very weak muscle because they use it only when they come,
and they come only infrequently and not powerfully. The process of
strengthening your PC muscle consists of a series of flexing or tightening the
muscle, then trying to hold, so at the moment of orgasm the male is able to hold
back the fluid and refrain from ejaculating while still having orgasm.
You need to experiment with it as you approach orgasm by tightening. The worst
that can happen is that you'll ejaculate, and with continued training you'll no
longer slip until you want to. Why is this beneficial? Well, aside from the obvious
reasons of increased male pleasure, it seems to me that the male's inability to
function over long periods has been one of the major contributing factors to the
poor state of sex in America. And the fact that he's been taught that he's all
through when he comes, rather than that he could go on indefinitely. If you simply
spend a few minutes a day exercising the right muscle, then you would
doubtlessly have many grateful partners through the years, rather than having
trouble erecting, coming too fast and so on.
The two exercises that you will need to be doing to enhance your sexual power
are named "cut-offs" and "Kegels" or PC Flexes. All males and females more or
less unconsciously perform a few cut-offs when they are through passing urine
and forcefully expel the last few drops. When you perform a forceful cut-off you
are literally turning off a faucet; so when the machinery within your faucet (PC
www.menshealthprogram.net
muscle) becomes powerful you will easily be able to turn it off at the point of
orgasm.
Discharged semen causes a loss of tension, but when the semen flow is cut off
and retained, you can keep your "member in good standing" and come again and
again (without ejaculation).
Cut-offs will help you identify your PC muscle and become familiar with its
strength. Every time you urinate, stop the flow forcefully at least six times. The
first time you try this, don't worry if all you can manage is a momentary
interruption in the flow.
PC Flexes can be performed anywhere at any time. They consist of tightening
the anal sphincter (rectum) and the muscles at the base of the penis. When you
do a correct PC Flex your penis will move slightly. You are doing PC Flexes
when you have an erection and you tighten to make your penis move up and
down.
Once you get use to tightening and flexing your PC muscle there are other ways
this can be performed using your erection and a bath towel; you simple hang the
towel over your erection and forcefully raise and lower your penis from 50 to 100
times. The idea is to give the penis some extra work to do. As the muscles get
stronger, the erection will get harder, partly from the increased blood supply the
exercise is causing your body to provide. Go slowly at first, but within a week or
10 days you should be able to perform 300 forceful PC Flexes a day and within
two months your muscle will be several times as strong as when you started.
PC Flexes can be unobtrusively performed (without an erection) while walking,
sitting or lying down. If you do them with an erection it's a good idea to hold a
warm wet towel or wash cloth over the top base of the penis afterwards; this
soothes and relaxes the vigorously used attachment muscles.
Within approximately six weeks after you've begun doing cut-offs and PC Flexes
daily, you'll be having longer, stronger, and better orgasms than ever before and
closer to both climax control and the sustained pleasure of multiple orgasms.
Cut-offs will give you the feel of turning off your faucet and they will enormously
benefit your control. The PC Flex will further develop control and your PC;
without a powerful pubococcygeus muscle you cannot hope to become
multiorgasmic.
The male who possesses a really powerful PC can maintain a firm erection for
hours and enjoy more ecstatic orgasms during one sex episode then most men
enjoy in a month. So get started on this simple sex-strengthening program and
turn your female's fantasies into fact.
www.menshealthprogram.net
EXTREMEPENIS.COM- WORKOUT CHART
It is important to accurately measure your penis before beginning the program.
This will allow you to keep track of your progress. Be sure to measure exactly.
Do not round up. This chart will be useful in tracking your weekly gains. We
suggest that you measure your penis only once a week. Although you may see
daily gains, measuring only once a week will allow you to see more of a gain and
keep you from becoming discouraged. As the chart shows, you should measure
your penis when it is both erect and flaccid. Be sure to also measure the girth in
a flaccid state and an erect state.
Week Number Length Erect Length Flaccid Girth Erect
www.menshealthprogram.net
Girth Flaccid
Most people pay a lot for this info.
Welcome to the ground breaking :15 Minute Solution!!! When it comes to penis enlargement sites on the
Internet, it is the opinion of the editors of The Penis Enlargement Guide.com that most authors are missing
the boat. We believe LESS IS MORE! Do you want to spend countless hours reading about penis
enlargement or would you rather have your time freed up to perform the techniques for consistent and
substantial gains? There is no method out there that requires 83 moving parts. These other authors are also
missing out on providing their readers with any direction for what to do with their material. Well, we've
taken care of all that for you. The :15 Minute Solution is a simple 5 exercise, 15 minute a day program that
will give you results without all the frustration associated with other available programs! Don't get beat up
like our friend shown below!
Enough of the crap...let's learn the techniques that will thicken and lengthen your penis, put an end to
premature ejaculation, give you a Prostate Gland that will perform for you into your later years and get you
ejaculating like Peter North!
The four exercises are listed below. You may click on any of the exercises and it will jump you down the
page to that exercise. After you've learned the techniques go to the table at the bottom of the page and just
follow the workout planner! It's all way too easy!
Shoot like a porn star!
Go to GREAT Lengths!
Attain Massive Girth!
Amazing Isometrics!
Kill the "Short Order Cook!"
Shoot like a porn star!
We've put this exercise first for a damn good reason. It's the cornerstone to a healthy, proper functioning
reproductive system. Mastering this technique will strengthen your Prostate Gland giving you a healthier,
better developed Prostate Gland. Additionally it will improve circulation for enhanced size, give you
ROCK HARD erections and the ability to ejaculate WHEN YOU WANT TO, allow multiple ejaculations
without ever losing your erection, increase the volume and intensity of your ejaculations, provide improved
urine flow, better stamina and give you a stouter-looking penis! We will never be able to emphasize enough
how very vital this technique is to a healthy and long life and sex life! This technique is based on the
discoveries of a Gynecologist who discovered the PC Muscle and devised an exercise which now bears his
name - Kegel.
Yes, "Kegels" were created by a Gynecologist back in the '50's. His goal was to find a way to assist women
with the demands of child birth and more importantly to help women recover from the experience quicker
so they may sooner be able to tend to their newborn child. He also set out to help women find a natural
solution for incontinence both after child birth and as women entered their later years. It's only been in the
last 10 - 12 years that the benefits of Kegels have been clinically studied and proven effective for men with
the incredible benefits we outlined above.
First, let's find this dude. Have you ever made your penis "move" without using your hands?!? You made it
move by flexing your PC Muscle. It's the only way you can do it! If you can't make your penis move (you
need this exercise more than you know!) then, next time you urinate, stop the flow of urine by flexing your
what? PC Muscle! Now that we've found it we need to know what to do with it!
There's a crucial point of learning to get the most out of doing Kegels - PUT YOUR MIND IN THE
MUSCLE! What do I mean by that? Simple. Once you feel where the "flex" is coming from, concentrate on
that exact point in your body and nowhere else. It's an old body-building adage to put your mind in the
muscle. It's old, but it is still taught today - because it works! It's the single-most effective way to target the
muscle DIRECTLY and to KEEP IT IN THE CROSS HAIRS! When you feel the flex in the PC you'll then
know HOW to perform a Kegel.
For the :15 Solution you'll be doing Kegels for 2 solid minutes. We've found that you can get just as an
effective workout in 2 intense minutes of Kegels as you can from doing as many as 300 reps. The terrifying
thing is that a lot of PE Sites will have you doing anywhere from 300 - 600 Kegels every single day forever! This is ridiculous and it violates everything we know about working out a muscle. You need
recovery time or the muscle will ATROPHY (shrink!!!)! With this in mind what you'll do is make a slow,
solid contraction, hold for 30 seconds, release and repeat 4 times. That's all that's necessary to effectively
work your PC Muscle and gain all the benefits we've already outlined for you above.
Go to GREAT Lengths!
This first enlargement technique is highly effective for lengthening the penis. The premise is simple enough
and performing this technique is even easier. All you have to do is gently grasp your Glans (penis head)
and pull, without letting up (except as noted below), for 5 full minutes. Here's the technique:
Pull straight out from your body and hold for 60 seconds. Now let go for 5 seconds and shake your penis
around to get the blood flowing back into your Glans.
Pull straight towards the floor for 60 full seconds then shake your penis around to get the blood flowing
back into your Glans.
Pull straight towards your chin for 60 full seconds then shake your penis around to get the blood flowing
back into your Glans.
Pull to the right for 60 full seconds then shake your penis around to get the blood flowing back into your
Glans.
Pull to the left for 60 full seconds then shake your penis around to get the blood flowing back into your
Glans.
The additional benefits of this exercise is your penis is now well warmed up and prepared for the Massive
Girth Technique!
Attain Massive Girth!
This exercise requires a bit more instruction but it's easy to perform once you know the nuts and bolts of
the technique. We're going to spend some extra time here because there are some caveats (warnings) about
this technique:
This technique is to be performed in a partially erect state. If you become too aroused during this technique
injury to your blood vessels may occur! You will need to stop and allow yourself to "come down" prior to
continuing.
This technique should alwaysfollow the lengthening technique. Blood spotting, bruising and mild
lumpiness (all temporary conditions) may occur without being properly warmed up for this technique.
You'll be gripping your penis firmly for this technique, but again, too firm a grip may cause damage to your
blood vessels. You'll have to find a firm yet gentle grip for this technique.
You're going to need a good lubricant for this exercise and maintain the viscosity for the duration of the
exercise. We recommend Baby Oil or K-Y Jelly.
Here's how to perform this exercise that will both greatly thicken as well as lengthen your penis:
The first thing to do for this exercise is to attain a partial erection. The purpose of this is to get some blood
into the penis - for it's the movement of the blood throughout the penis during this exercise which will
expand Your erectile tissue.
Using your index finger and thumb, wrap your penis at the base, way down as close to your testicles as
possible.
Gently squeeze your penis with your thumb and forefinger to trap the blood inside your erectile tissue.
Now, slide your thumb and forefinger "ring" down the shaft of your penis towards the glans (penis head).
At the moment your first hand reaches the glans, take your other hand and begin the same process. You'll
be alternating hands - right, left, right, left, etc. A single repetition should last a full second before starting
with your other hand.
Remember, for now we're just teaching you the exercises. At the bottom of this page is The :15 Minute
Solution - the program where we put all the elements of the program together for you and give you a
workable plan for implementing these exercises.
Amazing Isometrics!
This is a key technique for realizing consistent gains from years and years to come if you so wish. What
this exercise does is it Isometrically expands the smooth muscle tissue found in your penis and it
consistently and continually expands the elasticity of the penile tendon making unlimited gains possible!
You may wish to use a hand towel for this technique. Here's how to do it:
This exercise requires a full blown erection to perform. Once you are maximized, take the palm of your
hand, facing towards the floor and cup it over your glans (penis head). If you wish to use a hand towel it's
just as effective and we'll explain how as we go through this.
Now, slowly and gently, push your penis towards the floor. Go as far as you can comfortably go but not
further than parallel to the floor. If you're using a towel, gently pull the ends of the towel towards the floor
to lower the angle of your penis.
Very slowly, and with great care, begin to flex your PC Muscle by doing a Kegel - just as you learned
above in Shoot Like A Porn Star! The secret is to not allow your hand (or towel) to be moved by your penis
as your penis fights against your hand (or towel) to raise back up towards your chin.
Once you attain a solid flex of the PC Muscle through your Kegel hold your Kegel flex and your hand (or
towel) in place for 10 seconds then slowly release your Kegel and allow your penis to rise back up by
lifting your hand (or the towel) from your penis.
Re attain a maximized erection for the next rep. You should be able to repeat this process 5 times - once per
minute - for the :15 Solution.
Relatively simple stuff! Next we're going to look at how you can put an end to premature ejaculation
forever!
Kill the "Short Order Cook!"
We know that many men suffer from Premature Ejaculation and even more men wish they could just last
longer. This is a fantastic technique that will give you unlimited staying power...you'll be able to cum when
you're damn good and ready and never sooner! This exercise is not a part of the :15 Solution...it should be
done at a time when you're feeling like having a little fun - solo! Here's how it's done:
Start with some warm-ups. Slowly flex your PC Muscle and release 30 times. On the last flex, hold the
contraction of your PC Muscle as long as possible, up to one minute.
Repeat entire process.
Next, massage your penis continually until you're at the brink of ejaculation. The moment you feel the urge,
CLAMP DOWN ON YOUR PC MUSCLE AS HARD AS YOU CAN (remember, this is an INTERNAL
squeeze!) and take quick breaths in through your nose and out through your mouth. Use the power of your
mind to hold back your ejaculation! Keep holding the clamp on your PC until the urge has completely
subsided.
Again, you'll want to massage your penis to climax and then CLAMP DOWN ON YOUR PC MUSCLE!
Follow your breathing as you did before and your visualization.
Now, do 300 (minimum) PC Flexes as you learned above.
Finally, bring your penis to climax again. This time, let it fly!
Finish up with a nice hot towel wrap.
Above are all the exercises you're going to need for the :15 Solution. If you suffer from premature
ejaculation please feel free to work on that on your "off days" from the workout planner below. There's 2
tables below. The first is your :15 Solution Workout. After that is a Workout Planner for integrating the :15
Solution into your Fitness Routine found in The Poor Man's Guide to a Weightless Workout.
THE :15 SOLUTION:
Follow the exercises in the left column - the "X's" indicate the minutes
Exercise: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
Go to GREAT Lengths! X X X X X
Attain Massive Girth!
XXXXX
Amazing Isometrics!
XXX
Shoot like a porn star!
XX
INTEGRATING THE :15 Solution WITH YOUR FITNESS PROGRAM:
Here's your overall workout planner:
Monday Tuesday Wednesday Thursday Friday Saturday Sunday
WORKOUT AEROBICS WORKOUT AEROBICS WORKOUT AEROBICS OFF DAY
Kill the "Short Order Cook!" :15 SOLUTION Kill the "Short Order Cook!" :15 SOLUTION Kill the "Short
Order Cook!" :15 SOLUTION OFF DAY
As you can see by the above chart, on the days you workout you should perform the exercise routine that
will end Premature Ejaculation. If you're not a PE sufferer just do your Poor Man's Guide to a Weightless
Workout. On your Aerobics day you'll also perform the :15 Solution!
Like we said before, penis enlargement is not brain surgery...it's actually quite simple. We GUARANTEE
you'll get better results with the :15 Solution than with any other program available on the market ANYWHERE!
------------------------------------money making stuff --------------------Ok so theirs only 6 ways to make money in this list,
I weeded out all the crap that never paid out in the six years I have been doing this on line money making
thing.
------------------NEW!!!
Site in pre-launch Join Free!!!
Will Go live in December!
http://www.go-4-dollars.com/index.asp?SP=buggsy3
-------------------Quick Profit Downline Club
http://www.quickprofitclub.com/indexnew.asp?ID=7880
They will build you a down line of hundreds instantly.
Join FREE!!!
--------------------Positive Promotion Club--(I make about $95 a month and growing as of November 1st! with this one)
The hottest affiliate program on the net. Launched in early 2002.
http://positivepromotionclub.com/default.asp?refer=buggsy3
Paid Instantly every Month!
Matrix money system does not require any direct referrals!
-------------------Six Figure Income- Join FREE
http://www.ezinfocenter.com/823741
-------------------Going Platinumhttp://www.goingplatinum.com/member/buggsy
-------------------InBoxDOllars- Join FREE (The only Paid email program I have ever goten paid by)
http://www.inboxdollars.com/signup.php?ref=0078213
This one is my favorite, with the gold membership
They build your down line for you!!!
--------------------Explode your web traffic with these two Programs!
Join Free!
http://www.hitsense.com/?ref=buggsy3
http://freetrafficboost.com/g.o/buggsy3
-Need more Hits to your web site?
http://www.iloveclicks.com/signup.asp?referrer=10081
http://www.clickthru.net/iconlink?host=204104
-------------------Domain Name Registration Cheep and easy!
http://www.ezinfocenter.com/823741/gd
----I Buy Mortgages.--Are you currently receiving payments on a mortgage that you own? Did you know that you could sell that
income stream in whole or only part of it? If you are currently receiving payments on a mortgage that you
own, and would like to sell all or part of it contact me for a free Quote.
http://www.timcrofford.com/mortgage.html
------------------I am living proof that the average computer literate guy
with the will to secede can make money online.
This was just a hobby till I started making money.
Buggsy3@yahoo.com
Tim@Timcrofford.com
Heavy Penis - Penis Enlargement System
A Manual Guide To Permanent and Safe Enhanced Sexual
Performance.
LEGAL NOTICE:
Nothing in this manual is meant as, or should be taken as medical advice.
While the techniques described in this manual have worked well for many men
including the author, we are all individuals and they may not be appropriate
for you. Before trying any of the techniques in this manual you should
consult with a licensed Physician and/or Sex Therapist. If you are
interested in penis enlargement you should consult a licensed Physician
and/or Urologist. Because no two people are alike and you may have special
needs, all penis enlargement techniques should be done under the supervision
of a licensed Physician or Urologist.
This manual is meant for informational purposes only. Neither the Heavy Penis developers nor the
author shall be liable or responsible for any
loss, damage, injury or ailment caused or alleged to be caused, directly or
indirectly by the information or lack of information, or use or misuse of
the methods or techniques described in this manual.
Contents:
Introduction
Health & Nutrition
High Octane Sexual Fuel Diet
Supercharging Supplements
Charging Up Your Batteries
Drugs and other Hazards
Becoming A Man of Steel
Penis of Steel
Strong as Steel
Hard As Steel
Lasting All Night Long: Delay Techniques
Identifying The Point of No Return
Techniques
Breathing
Stop!
The Squeeze
The External Prostate Point
The PG Pump
PC Pumping
Focus Control
Position Yourself for Success
The Medicine Man
Thrusting Techniques 101
Taoist 9 in 1
Tease and Please
Slide and Glide
How to Screw Her Good!
Making it Bigger: The Penis You Always Wanted
The Jelq Technique
The Taoist Techniques
The Stretch Technique
Vacuum Pumps
The Program
Attitude & Belief
Visualize the size
Introduction
Congratulations on you purchase of The Heavy Penis - Penis Enlargement System Manual.
In this manual you will learn about your penis, you will learn how to make it
harder, longer and thicker and even more important as many women will
attest, How To Use It! I will show you how to banish premature ejaculation
forever. You will learn the most ancient and the latest techniques for to
gain true mastery of your penis. Before long you will have the sexual
prowess of a porno stud!
There is one catch. Like anything else in life, to become a master it takes
work, dedication and consistency. I mean you would not expect to walk into a
Dojo (Martial Arts Studio) and come out with a black belt the same day, or
be able to do the splits after stretching only once. Would go to the gym and
come out looking like a bodybuilder after only a few workouts would you? Of
course not!
The same truth applies here as well. And the same attitude is required as
well. You can make significant gains in size, staying power and technique
but it will require dedication and a commitment on your part. A commitment
on your part to follow the techniques taught to you in this manual on a
regular basis. The reason I use the analogy above is that it is quite
appropriate, as we will be practicing techniques like they do in the martial
arts. In fact many of the techniques you will be learning were taught in
ancient Asia by the Taoist (pronounced Dao-ist) as sexual Kung Fu. We will
also be stretching tendons and ligaments like they do in the martial arts
and like a bodybuilder we will be building muscle as well.
So enough said let’s get down to business! The Business of building a Big,
Hard, Strong, Penis. And becoming the master of your sexual destiny.
Health & Nutrition
Your penis is not a separate entity from your body. It is part of your body.
So if you are in poor health you should not expect your penis to be in any
better health than the rest of your body. If you are under great stress,
deprived of quality sleep and rest, suffering from an illness or are just
malnourished due to a nutritionally deficient diet, you may lack the penis
performance that you desire.
But all is not lost as in the next few pages we will cover the basics of
nutrition as well as foods and supplement that specifically enhance sexual
performance.
High Octane Sexual Fuel Diet
The food you put into your body is what your body burns as fuel to make
energy and just like when you put cheep gas in your car and you get poor
performance the same goes for your body. The quality of food you eat can be
a major factor that helps to determine your energy level, general health and
sexual performance.
What should you eat? You might ask?
You should eat a well balanced diet with plenty of fresh fruits (apples,
bananas, peaches, pears, grapes, oranges etc.) and vegetables (spinach,
broccoli, asparagus, squash, green beans, carrots, etc... green and leafy
vegetables are the best!) If you don’t like to eat vegetables you can drink
fresh vegetable juice, not canned. When a product is canned it loses many of
its vitamins, nutrients and enzymes, so you should always try to eat fresh
foods. You should also eat a high quality protein every day, such as fish,
chicken, and egg whites. I believe that beef meat should be eating only 1-4
times a month. If you really like red meat, you might try ostrich or
buffalo; they are much leaner and healthier. When you buy your food you
should try to get as much of it organic (grown with out pesticides and
without preservatives) as possible. I recommend that you get a copy of the
Zone Diet book. It basically says that you should eat 30% Fat (good fat,
avocados, nuts, etc.) 30% Carbohydrates (in the form of non-starchy
vegetables) and 40% Protein (Fish, Chicken, Etc.) at every meal and that
you should avoid refined sugar.
What you should you not eat?
Refined sugar (candy, soft drinks, pastries, white sugar, brown sugar, etc.)
Preservatives (Sodium Benzoate, Sodium Nitrate, Sodium Ethoborate etc.)
Food Additives (MSG or Mono-Sodiumglutinate, NutraSweet or Aspartame,
hydrolyzed animal or vegetable protein these are excitotoxins and stimulate
the neurons in the brain until they die! Food Dyes, etc.)
Start reading the packages of what you eat. Look for the hidden sugars
(sugar, high-fructose corn syrup, maltodextren), preservatives and food
additives on the labels of what you buy. A good rule of thumb is if you
can’t pronounce it you might not want to eat it.
Try to as eat little processed food as possible. Processed food are
ready-made food. Such as canned foods and processed cheese, frozen dinners
etc.
I don’t expect anyone to forgo all of the above all of the time. I love a
good piece of Triple Chocolate Cake or Chocolate Cookies, but I don’t eat it
everyday! Better yet save up you chocolate allowance and put chocolate syrup
on your woman’s nipples! One more note before we move on. Two things that
you should also avoid are aluminum and fluoride, which is a by-product of
aluminum and used as rat poison. Aluminum has been linked to Alzheimer’s
Disease. You might ask how you avoid aluminum? Don’t drink out of aluminum
cans, or cook in aluminum pots and pans. Go get you’re deodorant right now,
and read the label, if it says aluminum don’t use it anymore. And as for
fluoride, from what I have read from some dentist that have written on the
subject, IT DOES NOTHING FOR YOUR TEETH! And is aluminum by product.
Supercharging Supplements In addition to healthy foods
you can take vitamin and mineral supplements to
help make up for what our foods lack today. I recommend that you see a
nutritionist or buy a book on the subject of nutrition. Until you do I will
tell you what I take. Colloidal Minerals, B-Stress Complex, Vitamins C, E, A
and Zinc which is very important for prostate health and in fighting off
infections. Many companies are now making zinc lozenges, because if you get
enough at the on set of a cold you could be over the cold in 24-48 hours or
at least have less severe symptoms.
And now for the sexual performance boosting supplements:
B-Stress Complex for more energy
B-12 For more energy
Colloidal Minerals for general health and immunity
Amino Acid: L-Arginine: for erections of steel and increased volume
of ejaculate. I found this one through an obscure magazine article about a
year ago. It Works! I take 500-1000mg in the daytime and 1000-1500mg about
an hour or two before sex. Warning: Do not take L-Arginine during a herpes
break out or when cold sores are present, or any herpes related disease as
it will make the case more severe. I also recommend that you take good a
amino acid supplement and augment it with the L-Arginine as not to create an
imbalance in the body. I do not recommend taking high dosages on a daily
basis for an extended period of time.
Herb: Avina Sativa (Wild Oats): Increases sex drive and volume of
ejaculate.
Herb: Saw Palmetto Berries Extract: Good for prostate health.
Herb: Muira Puama Extract: Increases sex drive, and produces firmer
erections I have heard.
Herb: Yohimbe: Some people have had great success with this herb
and claim great results. I don’t recommend it, because I have heard that it
has negative side effects if over used or used for extended periods of time.
Herb: Damiana: Increases sex drive. I have also heard that the user
of this herb will become more attractive to the opposite sex.
Herb: Schizandra: It is said to increase the volume of sexual
fluids, increase sexual endurance and staying power and to strengthen the
whole body. One Added benefit is that it beautifies the skin.
Herb: Epimedium: Also known as “goat sex herb” considered an
aphrodisiac.
Herbal Formula: Honeymooners Tea: This tea is for replenishing
spent sexual energy. Dendrobium, Schizandra, Licorice root. You boil all of
the herbs and drink the tea.
There are many great Chinese herbal formulas that may benefit you in
countless ways. I recommend that you see a Chinese Tonic Herbalist to take
advantage of them. Consult your doctor and/or nutritionist before taking any
of the supplements or herbs listed here!
Charging Up Your Batteries
If you want to be a sexual athlete you need to get plenty of rest and sleep
so that your batteries are charged up so to speak, So that when you need the
Super Sexual Energy it is there. The Ancient Taoist believe that a man
should retain his ejaculate when he has his orgasm so that he does not lose
his energy and feel drained after sex as many men feel. How ever they
believed that men should have sex very often without ejaculating in order to
cultivate energy for well being and rejuvenation. Many professional athletes
abstain from sex before a competition so that they are at their peak, energy
wise; this may lend some creditability to the Taoist theory. Weather I
choose to believe in the Taoist theory or not one thing I have learned is
that you can have sex all day and sleep all night or have sex all night and
sleep all day. But you can’t work all day, fight traffic, go to the gym and
then have sex all night and get up for work early the next morning and do it
all over again for very long with out it taking toll on your health and
immunity. The Taoist may have the answer to this problem and we will explore
in more depth later on, but for now just realize that you need adequate rest
and sleep to have great sex and great erections.
Another Taoist theory is that you tell your health and well being by your
penis. According to the theory you can tell when you are in good health and
when I you had enough rest by the firmness of your erections. The harder you
are the healthier you are and the more energy you have. This is not written
in stone, but I have found it to be true for me as the Taoists found it true
for them.
Drugs and other Hazards
As well as all of the other dangers of illegal substances they can also
effect you sexual function in a detrimental way. If you want to be a man of
steel you have to act like one. Moderation is the key here, but I find that
some drugs are too dangerous even with moderate usage, such as cocaine,
heroin, and ecstasy have been found to cause brain damage.
Many prescription drugs and antibiotics also may cause loss of sex drive to
the point of near impotence. If you are on prescription drugs, and this is
the case you should consult with your doctor, and a nutritionist and/or
herbalist for a solution to your problem.
Steroids can be very damaging to your sexual functioning in addition to the
possibility of damaging your liver, kidneys and heart. Some of the side
effects of steroids to the reproductive system are that you balls may shrink
and you testosterone production may be significantly reduced.
We all know that smoking Cigarettes is bad for your health. But you may not
know what it does to your sexual performance. When you smoke you decrease
the blood and oxygen supply in your arteries and you’re sexual performance
and firmness of your erection decreases. That would be enough right there
for me to quit!
Alcohol in moderation is not bad, in fact medical studies have now shown
that 1 drink a day may even be good for you! We all know that too much
alcohol decreases your ability to perform sexually. So once again moderation
is the key.
Becoming A Man of Steel
If you want to be a man of steel and have a penis of steel you have to live
like a man of steel. Which means that you need to eat like a man of steel,
sleep like a man of steel, exercise like a man of steel. I don’t want to
turn this into bodybuilding or exercise guide, but I will say that if you
are not already active, you should be. I recommend joining a gym (A great
place to meet women) and getting on weight training program. This will not
only make you feel better, but you will also look better and be more
attractive to the opposite sex. If you really can’t stand lifting weights,
you might try martial arts classes, where not only will you get a work out
but you will also learn to defend your self and increase your self
-discipline and self-confidence. Other suggestions might include Aerobics,
Boxercise, Running, or Biking.
Penis of Steel
Now lets get down to business, and build a penis that is as strong as steel,
and as hard as steel. In order to do that we need to first strengthen the
muscles that are responsible for your orgasms and ejaculation, the
Pubococcygeus muscle or PC muscle (Figure 1). But first we need to locate it
if you are not aware of it. The best way to find it is to urinate and try to
stop the flow of urine, when the flow stops you have found your PC muscle.
Now flex your PC muscle a few times to make sure you have found it. As with
any muscle without use it will atrophy and unless you have been doing a PC
muscle workout already on a regular basis you could probably use some
strengthening and toning. So now we will start a PC muscle exercise program.
Strong as Steel
The Strong as Steel Exercise Program
The first exercise we are going to do is the Quick squeeze:
Squeeze your PC Muscle as tight as you can and hold it for 2 seconds then
completely relax the muscle. That is one rep, wait 1 second between reps.
Next is the Slow Squeeze:
Squeeze your PC Muscle as tight as you can slowly and hold it for 15 seconds
then release slowly, completely relax the muscle. That is one rep wait 5
seconds between reps.
And last is the Super Squeeze:
Squeeze your PC Muscle as tight as you can slowly and hold it for a minimum
of 60 seconds then release. That is one rep wait 60 seconds between reps.
Daily Program:
Quick Squeeze: 20 reps. (work up to 100 reps.) x 1 set.
Slow Squeeze: 10 reps. (work up to 25 reps.) x 1 set.
Super Squeeze: 1 reps. (work up to 10 reps.) x 1 set.
Just as with any exercise program you should start out slow and build up
over time, in this case over about 2-3 weeks to prevent excessive soreness.
After being on this program for 4-8 weeks you should have a super strong PC
muscle. Which is required for many of the techniques in the following
sections.
Some of the added benefits of PC muscle exercises are more intense orgasms,
stronger and more powerful ejaculation, and the ability to become a
Multi-Orgasmic Male. PC muscle exercise also promotes good prostate health,
by massaging the prostate gland with the contractions of the PC muscle.
Hard As Steel
There are many different variables that can factor in to the hardness of
your penis, such as general health and lack of sleep that we covered in
earlier sections. Another factor is the strength of your PC muscle. The
stronger your PC muscle is the harder your penis will be, and when your
penis is at it’s hardest, your penis will also be at it’s biggest. Also as
mentioned earlier a program of herbs, vitamins and supplements can help turn
a weak erection into a Steel Rod! The ones that I have found to be most
beneficial to increase the hardness of erections are the Colloidal Minerals,
B-Complex, and L-Arginine (The Secret Ingredient, this one alone should make
you rock hard if taken correctly and you are in general good health I take
500-2000mg’s a day 500-1000mg’s in the morning and 500-1500mg’s 2 hours
before sex. Then get ready for a super hard erection, in some cases
increased staying power and a Mega Load Ejaculation. If this does not happen
the first time take the dosage for a few days in a row).
Lasting All Night Long
A penis no matter how big or hard is of very little use to anyone if you
have no control over it. Many men suffer from premature ejaculation as we
will define it (ejaculating before you are ready to.) This can be a great
insecurity to a man’s sexual self-image and cause much frustration to his
sexual partner as well. Now we will learn some techniques to help end this
problem forever!
Identifying The Point of No Return
Before you can control your ejaculation you must be able to recognize when
it is that you are going to ejaculate or, as we will call it the point of
ejaculatory inevitability or the point of no return( P.O.N.R). In order do
this you have to do some exercises so that you will be able to identify your
P.O.N.R.
Exercise #1: Finding your P.O.N.R. and Excitement Scale.
Goal: Finding your P.O.N.R. and Excitement Scale.
Repeat until you accomplish the goal to your satisfaction..
You will want to take about 30 min. to do this.
You should do this alone and without any added stimulation (Pornographic
Material unless absolutely needed). You should pay attention to every nuance
and subtle feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all
of the feelings you feel along the way to your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5,
etc.(1 being lowest or semi-hard and 10 highest and the P.O.N.R.) along the
way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your
stroking, the tightness of your grip, what you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate
with out finding your P.O.N.R.
6. When you get to a level about 9-9.5 pay real close attention to what you
are feeling. You should start to feel the seamen moving from the testicles
and collecting in the prostate gland at the base of the penis.
7. If possible stop and take a deep breath and feel everything. If you can’t
stop then you have passed your P.O.N.R.
8. See how close you can get, then let your self ejaculate and enjoy it!
Now that you have identified your P.O.N.R. and you can tell when you are
approaching your P.O.N.R. all you need is to learn how to slow your path to
orgasm which we will cover in the next section.
Delaying Your Orgasm
Now we will cover several techniques in this section that will enable you to
Delay and/or prevent your orgasm and prolong lovemaking for as long as you
desire. Some of the techniques will work better for you than others and many
can and should be used in conjunction with each other. We will start with
the simplest leading to the more advanced with each technique building on
the previous.
Delay Techniques:
Breathing
This one is fairly simple but very powerful when combined with the other
techniques. That is why you are going to learn it first.
First we need to see if you know the proper way to breathe. Put your hand on
your abdomen and take a deep breath, you should feel your abdomen fill with
air and your abdomen expand outward. Your shoulders should not rise.
Practice breathing like this until you get it down.
When you feel that you are reaching around 7.5 or 8 on the Excitement Scale
take a slow deep breath and hold it for a few seconds until the urge to
ejaculate subsides. Continue slow deep breathing until your level on the
Excitement Scale drops a few points. Warning: don’t hold your breath too
long you don’t want to get dizzy or pass out!
This technique may or may not work for you depending on how close to your
P.O.N.R. you are, but is very powerful when used in combination with the
following techniques.
STOP !
That’s it! Just stop and breathe! (As described above) When you feel that
you are getting too close to your point of no return, just stop what ever it
is you are doing take a deep breath and just wait 20-60 seconds before you
resume any form of stimulation. Once you feel that your arousal has dropped
a few points on your excitement scale you then can resume stimulation.
The key to making this work is to really stop. If you are with a lover you
maybe concerned that you will look silly or deprive her of her pleasure. If
you use finesse you will be able apply this technique properly without
either of the two happening. The key to doing this is not to let your lover
feel isolated during your break.
Scenario A: Let’s say your lover is going down on you and you are getting
close to your P.O.N.R. and you haven’t had intercourse yet.
A few ways to handle this are as follows:
1. Say “baby, that feels so good, but I don’t want to come yet! Could you
stop for a few seconds!” Most women would be very happy to help you out,
especially if your are with a steady lover.
2. Say “ Ohh, God you are so good!, Come here!” and pull her up, take a deep
breath and kiss her passionately during the 30 seconds or so..This will only
turn her on more and still give the break you needed..Then you can gently
guide her back down there or move on to another activity. If you need even
more of break you could suck on her nipples or go down her..
3. Pull her up and say “ My Turn!” and go down on her while you take your
needed break. Very few women will argue with this request!
Scenario B: You are having intercourse and you can tell that it won’t be
long before you reach your P.O.N.R.
A few ways to handle this are as follows:
1. Say “baby, Your pussy feels so good, but I don’t want to come yet!” Stop,
Pull out, take a slow deep breath (If just stopping without pulling out
works for you then great, but many times it won’t be enough, also she my
keep moving especially if she is on top) and take a break. Most women are
very happy to help you out, especially if your are with a steady lover.
WARNING: If your lover is screaming “Don’t stop I’m about to come”, this is
not the time for this technique, even if you want to last past her orgasm.
2. Stop, take a deep breath and, change positions. This will only work if
you have been in one position for awhile. Also the best position to move to
is her favorite, unless this was it! Then you might not want to change.
3. Pull out, take a deep breath, tell her how pretty her pussy is or how
much you love her pussy, go down and kiss her or her pussy a few times,
while you take a break.
4. Pull out, take deep breath, slide the shaft of your penis over her
clitoris with a thrusting motion, and rub her clitoris with the head of your
penis and/or playfully slap and tease her pussy with your penis, while you
say something like “You like being naughty don’t you, I love your naughty
little pussy!” or some other verbiage that you come up with.. Be creative.
Exercise #2: Solo Practice - The Breathing and Stop! Techniques.
Goal: Experiencing and becoming familiar with the Stop! and Breathing
Techniques.
Repeat until you can confidently and successfully apply the technique to
delay your ejaculation and prolong sexual stimulation.
You will want to take about 45min. to do this.
You should do this alone and without any added stimulation (Pornographic
Material unless absolutely needed). You should pay attention to every nuance
and subtle feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all
of the feelings you feel along the way to your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5,
etc.(1 being lowest or semi-hard and 10 highest and the P.O.N.R.) along the
way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your
stroking, the tightness of your grip, what you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate
with out trying the technique.
6. When you get to a level of about 6.5 apply the technique:
Stop, Take your hand off of your penis, take a deep breath and hold for a
few seconds, slowly let the breath out and relax as your Excitement level
drops a few point on the scale. Pay very close attention to what you are
feeling as this happens. Start stimulating you’re self again and repeat the
above technique at levels 7.5, 8.5, 9.5.
7. See how close you can get each time, then let your self ejaculate and
enjoy it!
The Squeeze
The Squeeze technique is just what it sounds like you Squeeze your penis
with your hand. When feel like you are getting near your P.O.N.R. you do The
Squeeze in combination with the previous Breathing and Stop! Methods.
The Squeeze Technique:
1. When you feel close to your P.O.N.R. you, stop, pull out, take a deep
breath and squeeze your penis hard with your thumb and first two fingers for
several seconds. After your Excitement level drops a few points you may
resume intercourse. The squeeze should be applied either with the first two
fingers (this is a flat grip the fingers and thumb do not meet.) just below
the head of the penis.
2. Another variation is to squeeze you penis at the base instead of just
below. This can be done in the same manner described above or by gripping
the penis in a ring manner with the thumb and index finger. Try both and see
which works best for you. You may also be able to use the last variation of
griping the penis at the base without having to pull out, and simply just
stopping, taking a deep breath and applying the squeeze to the base of the
penis and waiting till the urge to ejaculate subsides.
Exercise #3: Solo Practice - The Squeeze Technique.
Goal: Experiencing and becoming familiar with the Stop!, Breathing and
Squeeze Techniques.
Repeat until you can confidently and successfully apply the technique to
delay your ejaculation and prolong sexual stimulation.
You will want to take about 45min. to do this.
1. You should do this alone and without any added stimulation (Pornographic
Material unless absolutely needed). You should pay attention to every nuance
and subtle feeling that you will feel.
2. Start with a limp penis and begin stroking until you are hard. Notice all
of the feelings you feel along the way to your P.O.N.R.
3. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5,
etc.(1 being lowest or semi-hard and 10 highest and the P.O.N.R.) along the
way to your P.O.N.R.
4. Try to stay at each level for about 2-3 min. Then move to the next.
5. Notice what it is that moves you to the next level i.e. the speed of your
stroking, the tightness of your grip, what you are thinking etc.
6. Move slowly to each higher level as to not get carried away and ejaculate
without trying the technique.
7. When you get to a level of about 6.5 apply the technique:
Stop, squeeze your penis hard with your thumb and forefingers just below the
head or with the ring grip at the base of the penis( I recommend that you
try both variations and see which one works best for you), take a deep
breath and hold for a few seconds, slowly let the breath out and relax as
your Excitement level drops a few point on the scale. Pay very close
attention to what you are feeling as this happens. Start stimulating you’re
self again and repeat the above technique at levels 7.5, 8.5, 9.5.
8. See how close you can get each time, then let your self ejaculate and
enjoy it!
The PG Pump
The PG Pump is actually an ancient Taoist technique to delay ejaculation and
can also be used during orgasm do prevent ejaculation. To use the PG Pump
you must first find your external prostate point. The point is located on
the perineum between your scrotum and anus, but closer to your anus
. The PG Pump technique can be applied with or without pulling out,
however the effect is greater if you do pullout.
Exercise #4: Finding your External PG Point.
Goal: To Find your External PG Point and become familiar with the sensation
of pumping it.
1. Stimulate your self until highly aroused highly.
2. You should be standing or in a kneeling position. Reach around behind
your butt and between your legs, then with your first two or three fingers
(depending on the size of your fingers) and press up on the area above your
scrotum and just below your anus fairly hard up to the first joint of your
fingers.
3. When you find the right spot you will feel a pleasurable sensation and
you will be able to see the head of your penis throb and expand as you
press. Press it a few times slowly and gently. Now you know how to pump your
prostate.
Now that you know where your External PG point is and how to pump your
Prostate lets apply this technique to practical use.
Exercise #5: Solo Practice - The PG Pump Technique.
Goal: Experiencing and becoming familiar with the Stop!, Breathing and PG
Pump Techniques.
Repeat until you can confidently and successfully apply the technique to
delay your ejaculation and prolong sexual stimulation.
You will want to take about 45min. to do this.
You should do this alone and without any added stimulation (Pornographic
Material unless absolutely needed). You should pay attention to every nuance
and subtle feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all
of the feelings you feel along the way to your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5,
etc.(1 being lowest or semi-hard and 10 highest and the P.O.N.R.) along the
way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your
stroking, the tightness of your grip, what you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate
without trying the technique.
6. When you get to a level of about 6.5 apply the technique:
Stop, press hard on your PG Point for several seconds, release (that is one
pump). Pump your PG Point 3-5 times, take a deep breath and hold for a few
seconds, slowly let the breath out and relax as your Excitement level drops
a few points on the scale. Your erection may decrease a bit as well. Pay
very close attention to what you are feeling as this happens. Start
stimulating you’re self again and repeat the above technique at levels 7.5,
8.5, 9.5.
7. See how close you can get each time, then let your self ejaculate and
enjoy it!
The PC Pump
The PC Pump is a internal and more powerful version of the PG Pump, but
instead of using you fingers to press on your external prostate point and
pump your prostate gland you are using Pubococcygeus muscle or PC muscle to
pump the prostate gland. To explain how this delays ejaculation we first
need to understand how ejaculation occurs. When you near you’re P.O.N.R. you
prostate starts to fill with prostatic fluid and fluid from the seminal
vesicles. Once you reach your P.O.N.R seaman is drawn from your testicles
into the prostate gland and then expelled with force by the contractions of
the muscles that surround the prostate gland. With the PC Pump and the PG
Pump what is actually happening is that you are interrupting this process
and restarting it in effect.
To be able to do the PC Pump you must have a very strong PC muscle. If you
have been doing some kind of PC muscle conditioning might want to try the
exercise now, if not you should start training and strengthening your PC
muscle with the Strong as Steel Exercise Program as outlined earlier in this
manual. After a couple of weeks of training you should do try this exercise.
Remember that you should continue the Strong as Steel Exercise Program
indefinitely to maintain a strong PC Muscle. As with the PG Pump, The PC
Pump can be applied with or without pulling out.
Exercise #6: Solo Practice - The PC Pump Technique.
Goal: Experiencing and becoming familiar with the Stop!, Breathing and PC
Pump Techniques.
Repeat until you can confidently and successfully apply the technique to
delay your ejaculation and prolong sexual stimulation.
You will want to take about 45min. to do this.
You should do this alone and without any added stimulation (Pornographic
Material unless absolutely needed). You should pay attention to every nuance
and subtle feeling that you will feel.
1. Start with a limp penis and begin stroking until you are hard. Notice all
of the feelings you feel along the way to your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5,
etc.(1 being lowest or semi-hard and 10 highest and the P.O.N.R.) along the
way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your
stroking, the tightness of your grip, what you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate
without trying the technique.
6. When you get to a level of about 6.5 it is time to apply the PC Pump:
There are several variations of the PC Pump technique, try them all and see
which one works best for you.
A. Stop, Flex your PC hard for 2-3 seconds, release (that is one pump). Pump
your PC Muscle 3-5 times, take a deep breath as you do the first pump and
hold for a few seconds, slowly let the breath out and relax as your
Excitement level drops a few points on the scale. You may also experience a
decrease in your erection. Resume stimulation.
B. Stop, Flex your PC Muscle hard for one long pump about 10 seconds,
release. Pump your PC Muscle 1-3 times, take a deep breath as you do the
first pump and hold for a few seconds, slowly let the breath out and relax
as your Excitement level drops a few points on the scale. You may also
experience a decrease in your erection. Resume stimulation.
C. Stop, Flex your PC Muscle hard for 1 second release and do it again
quickly, repeat for 5 reps., take a deep breath and hold for a few seconds,
slowly let the breath out and relax as your Excitement level drops a few
points on the scale. You may also experience a decrease in your erection.
Resume stimulation.
7. Pay very close attention to what you are feeling as this happens. Start
stimulating you’re self again and repeat the above technique at levels 7.5,
8.5, 9.5.
8. See how close you can get each time, then let your self ejaculate and
enjoy it!
Focus Control
These techniques are more mental than physical and since the mind is the
greatest sex organ these techniques are very powerful when combined with the
ones above. These techniques work by you directing your attention away from
your orgasm and onto other sensations, and at the same time keep you fully
present in the sexual experience.
Change your focus of goal: This is the easiest of them, this is more an
attitude than a specific technique. Change your focus and goal from having
an orgasm and ejaculation to enjoying and taking in the whole sexual
experience. the smell of her hair.. The feel of her skin, the way she
tastes.etc.By taking the focus off of ejaculation and putting it on the
whole experience, everything you do does not lead to ejaculating, but to
enjoying.
Exercise #7: Solo Practice - Change your focus of goal.
Goal: Experiencing and becoming familiar The Focus Control Techniques
1. You will want to take about 45min. to do this.
You should do this alone and without any added stimulation
(Pornographic Material unless absolutely needed). You should pay attention
to every nuance and subtle feeling that you will feel.
2. This time you are going to self-stimulate with the goal be pleasure,
instead of ejaculation you do not even have to ejaculate at all.
Start with a limp penis and begin stroking until you are hard. Notice all of
the feelings you feel along the way to your P.O.N.R.
3. Enjoy it!
Change your focus of physical sensation: In this one what you do is to take
you attention off of your genitals and place them on another part of your
body.
Exercise #8: Change your focus of physical sensation.
Goal: Changing your focus off of your genitals and put it on some other part
of your body.
Repeat until you accomplish the goal to your satisfaction..
You will want to take about 30 min. to do this.
You should do this alone and without any added stimulation (Pornographic
Material unless absolutely needed). You should pay attention to every nuance
and subtle feeling that you will feel.
1. Once again let pleasure be your goal, instead of ejaculation. Start with
a limp penis and begin stroking until you are hard. Notice all of the
feelings you feel along the way to your P.O.N.R.
2. Give each level of excitement a number between 1-10, 1.5, 3.5, 9.5,
etc.(1 being lowest or semi-hard and 10 highest and the P.O.N.R.) along the
way to your P.O.N.R.
3. Try to stay at each level for about 2-3 min. Then move to the next.
4. Notice what it is that moves you to the next level i.e. the speed of your
stroking, the tightness of your grip, what you are thinking etc.
5. Move slowly to each higher level as to not get carried away and ejaculate
with out finding your P.O.N.R.
6. When you get to a level about 6.5, shift you attention from what you are
feeling in your genitals to what the rest of your body is feeling. Feel what
your hands feel, feel what your skin feels.
7. If possible stop and take a deep breath and feel everything.
8. See how close you can get, then let your self ejaculate and enjoy it!
Change your focus on the external stimuli of your lover:
Many times what drives you past the point of no return is not just something
that you are feeling but also what you are seeing and hearing and what your
focus is on. For instance maybe you can last without a problem until you
lover starts to moan and scream, and when your hear how excited she is it
throws you past the your P.O.N.R. Or maybe it’s when you see her beautiful
full breasts hanging down while you are thrusting into her from behind or
any number of things. The point is to identify what it is that drives you
past your P.O.N.R. and then change you focus to something else about your
lover.
Many men change their focus to sport scores or something that turns them
off, I personally don’t think that you should think of something that you
find distasteful or negative to delay your ejaculation as you may
accidentally create an association between the two. If you feel that this
form of detachment may help you, change your focus to anything pleasant that
is non-sexual in nature instead.
However, I feel that it is better not to remove yourself from your present
sexual experience with your lover. It would be preferable to change your
focus to how much you love or care about her, how beautiful she looks, how
amazing the experience is, take in the whole experience the ambiance, the
mood, feel the sheets etc. Just change you focus to anything that is present
except the stimulus that drives you over the edge.
Exercise #9: Change your focus on the external stimuli of your lover
Goal: Changing your focus off of the part of her or the experience that
drives you over the edge and on to something else.
Repeat until you accomplish the goal to your satisfaction..
1. Once again let pleasure be your goal, instead of ejaculation.
2. Notice what it is that moves you up the scale. I.e. looking at her breast
bounce, watching your penis sliding in and out of her, the way her ass
looks, hearing her moan or what she is saying to you.
3. When you start getting close to your P.O.N.R. change you focus off of
whatever it is that is driving to wild and on to something else. i.e. if you
are watch her breast and it’s driving you wild, look into her eyes instead,
if you are doing it from behind and her ass is just too much for you look at
the wall for a while
4. Apply one of the other techniques that you learned earlier, like The PG
Pump or the PC Pump, both of which can be done without pulling out.
5. See how close you can get, then let your self ejaculate and enjoy it!
A Final Word on the Above Techniques
With all of the above techniques you don’t want to wait until you are at
your P.O.N.R. before you start to use them. But rather use them along the
way to your P.O.N.R. so that you may last as long as you desire and reach
your P.O.N.R. and enjoy your orgasm when you are ready rather than to be at
the mercy of chance or to just put up with premature ejaculation.
You may never have to hear again the words “I was almost there, I was so
close.” Instead, once you master these techniques you will be hearing,
“Ooooh, God, I’mmmm coming, Ooh! Fuck, Oooh! Ooooh! Ooooooooh!
Position Yourself for Success
Having intercourse in certain positions will help to last longer and prolong
intercourse. Positions that prolong intercourse: The Woman on top
positions, Spoons (side to side, man behind the woman).
The Medicine Man
Even though we already covered herbs and supplements earlier I would like to
mention a few that are help to increase staying power.
Supplements and Herbs for staying power:
Amino Acid: L-Arginine: for erections of steel and increased volume
of ejaculate and increased staying power. I take 500-1000mg in the daytime
and 1000-1500mg about an hour or two before sex. Warning: Do not take
L-Arginine during a herpes break out or when cold sores are present, or any
herpes related disease as it will make the case more severe. I also
recommend that you take a good amino acid supplement and augment it with the
L-Arginine as not to create an imbalance in the body. I do not recommend
taking high dosages on a daily basis for an extended period of time.
Herb: Schizandra: It is said to increase the volume of sexual
fluids, increase sexual endurance and staying power and to strengthen the
whole body. One Added benefit is that it beautifies the skin. Strongest in
the tincture (Liquid in alcohol base) form. Should be taken on a daily basis
according to the rules of Chinese tonic herbalism.
MMO or Male Multiple Orgasm
What is it?
MMO or Male Multiple Orgasm is the ability experience all the sensations of
orgasm without ejaculation, and therefore you can maintain an erection and
have many orgasms without ejaculating, until you desire to ejaculate. Some
men have developed or inherently posses this ability it seem while most
other men can learn to develop this ability.
The first prerequisite is a very strong PC muscle, so if you haven’t
developed your PC muscle yet, forget about MMO until you do. Secondly you
need a high degree of ability with the PC Pump Technique. You should be able
to stop your self from coming at the 9.5-9.9 levels. If not keep practicing
until you can. Once you can do that you must learn to stretch the duration
of the sensations that you feel when you are applying the PC Pump Technique
sensations.
A Technique for experiencing MMO:
Try the following technique during self-stimulation or intercourse.
1. When you get to a level of about 6.5 apply the PC Pump Technique Stop;
Flex your PC muscle for several seconds, release. Take a deep breath and
hold for a few seconds, slowly let the breath out and relax as your
Excitement level drops a few points on the scale. Your erection may decrease
a bit as well. Pay very close attention to what you are feeling as this
happens. Start stimulating you’re self again and repeat the above technique
at levels 7.5, 8.5, 9.5, 9.6, 9.7, 9.8,
2. Now Try it at and 9.9 and right before your P.O.N.R. flex your PC muscle
hard, for as long as you can, take a deep breath and hold it for a few
seconds, Open your eyes, and keep them open. Think of bringing the feeling
up and through your whole body.
3. Now if you did all of the steps correctly and you did not pass your
P.O.N.R. and your PC muscles was strong enough. You should have had a MMO
without ejaculating, and you should still have an erection or partial
erection and be able to resume stimulation.
4. If that’s not what happened, then keep practicing and soon you will be a
multi-orgasmic man.
Thrusting Techniques 101
Taoist Techniques and The Taoist 9 in 1 Technique
The Ancient Taoist had developed an extensive array of thrusting techniques
for intercourse. They believed that the man should vary his thrusting speed
and thrusting depth and thrusting angle in order to fully stimulate his
lover and himself during a prolonged coition (Taoist also believed in
prolong acts of intercourse and are famous for the term 1000 loving
thrusts.)
They also gave names to the different levels of depths in the vagina.
They are as follows:
1. Lute String, the depth of one inch inside.
2. Water chestnut Teeth, the depth of two inches.
3. Little Stream, the depth of three inches.
4. Black Pearl, the depth of four inches.
5. Valley’s Proper, the depth of five inches.
6. Deep Chamber, the depth of six inches.
7. Inner Door, the depth of seven inches.
8. North Pole, the depth of eight inches.
The Taoist 9 in 1 Technique
The 9 in 1 technique is a thrusting sequence in which you simply thrust 9
times shallow (1 to 4 inches) and 1 time deep (3 to 5 inches, but not so
deep as to hit her cervix and cause pain).
Example of one set:
Shallow Deep
19
28
37
46
55
65
73
82
91
Then you repeat the sequence over and over again varying the speed of the
thrusts. It is said that this sequence will stimulate the woman to all nine
levels
The Ancient Taoists also describe nine different types of thrusts. I have
endeavored to paraphrase from the overly poetic language used.
The Nine type of thrusts:
1. Thrust to the left and to the right to stimulate the vaginal walls.
2. Thrust up and down rather than in and out. You have to move your whole
body up and down do this in the missionary position.
3. Teasingly pull out and push back in.
4. Alternate between using deep thrusts and shallow teasing strokes.
5. Make deep and shallow strokes in steady succession.
6. Push in slowly.
7. Thrust Swiftly.
8. Poise at the opening, then strike swiftly and stay inside for a few
moments.
9. Rise and then plunge low.
Tease & Please
In this technique you tease your partner with your penis until she is
begging you to put it in her then you then you slowly enter her an inch at a
time until you tease an orgasm out of her.
The Tease & Please Technique:
1. After your partner is highly aroused from foreplay, you gently rub your
partner’s clitoris with the head of your penis. Every once in a while tease
the opening with the head of your penis. After a few minutes of this she
will be simmering with desire, but you want her boiling so keep on teasing.
2. She will ask you to put it in! DON’T PUT IT IN YET! Keep teasing and talk
to her. Tell her how beautiful her pussy is. Ask her if she wants you inside
her or if she want’s you cock inside her. Ask her how badly she wants it as
you keep teasing her. After a few more minutes of this she will be on the
edge of her seat and almost boiling with desire.
3. When she really can’t stand it any longer, start rubbing the opening with
the head of your penis for about a minute or so. Then slide only the head in
and vary slowly thrust in and out with only the head of your penis. She will
be begging for you to put it in more!
4. Slide it in one more inch, then trust slowly in and out but only to this
same depth. Keep talking to her while you do this. Ask her if she likes your
cock inside her, tell her how much you like fucking her and how good her
pussy feels.
5. After a couple more minutes slide it in one more inch and then thrust
slowly in and out to this same depth.
6. Repeat step 5 until you are almost at your full length, but don’t put it
all the way in until she starts having an orgasm.
7. Once she starts having an orgasm you may start thrusting more vigorously
and or move on to a different technique.
Slide and Glide
This one I originally learned form an uncle of mine who told me of this
great technique he used to give women orgasms during intercourse that had
never had one during intercourse before. A few years later I saw that a book
(by the title of “The Perfect Fit” had been written about a very similar
technique, but with much fluff added to fill up 100 or so pages.
This technique relies on stimulating your partners clitoris with the
friction and pressure from your upper pubic region (right above your pubic
bone) which we will call the Friction Zone (Figure 3).
The Slide and Glide Technique
The technique is done in the missionary position (there is a Woman on top
variation that I will go over later). Make sure your partner is well
lubricated, and I would recommend starting with the tease & please
technique, until you are almost all the way in and then start do this
technique.
The Slide and Glide Technique:
1. In the missionary position, make sure your partner’s clitoris and upper
vaginal area is well lubricated. (With her own juices, you saliva,
Astroglide, Wet, etc.)
2. Ask the woman to spread her vaginal lips with her hands, when she does
this put your penis in up to the base and rest the Friction Zone on her
clitoris.
3. Put your weight on her body, and reach down and grab her ass and spread
the cheeks apart.
4. Now start sliding up and down on her (not in and out, you penis should
remain in completely inside her all the way to the base as you move. To do
this you will need to grab her shoulders or the edge of the bed with both
hands and push off with your toes as well. As you do all of this make sure
that the greatest friction between you and her is where the Friction Zone
and her clitoris meet. This might all sound really complicated but it is
actually very easy, and after a few minutes you and her will be gliding back
and forth on a sweet layer of sweat.
5. Continue until she has at least one orgasm. Keep moving and try not to
break the friction.
How to Screw Her Good!
If you follow the techniques above you will be a good lover but you want to
be a Great Lover so here is the icing on the cake.
Many men just thrust in and out over and over again, or worse just put it in
and pound. While many women do like to be pounded on occasion or after they
have warmed up with an orgasm or two, the same thing over and over again can
get quite boring. It is best to vary the techniques that you use and to vary
the types, depth, speed, and angles of your thrusts as well as the positions
that you are thrusting in. Just as well don’t get carried away and keep
changing positions every couple of minutes if your partner really enjoys the
one you are in and is getting the stimulation that she needs for an orgasm.
To be a great lover you have to learn to read your lover adapt and go with
the flow and still be able to take the lead. You need to learn the way of
your lover, what she desires and what she does not desire, what spots get
her off and what really turns her off. These things come with time. That is
why the sex should get better the longer you are with someone not worse..
A few Suggestions:
1. Always tease a bit and make sure that your lover is fully aroused and
lubricated before penetration.
2. Make sure your lover is highly aroused and almost coming before full
penetration.
3. Thrust at different angles in the same position to stimulate all the
walls of the vagina. Try riding high and low, left and right in the same
position to stimulate all of her vaginal walls.
4. Try different positions, variety is the spice of life.
5. Thrust at different speeds, fast, slow, and medium.
6. Thrust hard, soft and teasingly.
7. Once in a while pull out and re-enter.
8. Try thrust in a winding circular motion going in and coming out.
9. Put you penis all the way in and slide up and down and left and right and
in circles clockwise and counter-clockwise, without moving your penis in and
out.
Making it Bigger: The Penis You Always Wanted
We all ask the question does size matter?
Sure it does, If you are too big she won’t sleep with you! There are some
woman that only like big cocks and there are some that don’t like big cocks.
I personally have run in more of the later than the former. According to
the famous East Indian love text the KAMA SUTRA both men and women come in
three sizes, essentially: Small, Medium and Large. And the most important
thing is for them to fit well together. A small man with a large woman is
not a good match, she will not get they will not get the stimulation they
need and vice versa A large man with a small woman also is not a good fit as
it will be painful for her or she may refuse intercourse all together.
Visually, a larger penis turns on some women (But not as many as men who are
turned on by having a larger penis) Most women like medium to big cocks in
general, but not huge cocks, they are actually afraid of them.. Also you
have to realize that a woman’s interpretation of medium and big are
different than ours. Most women think big is 6-7 inch and about 5 inches
around and we seem to think that big is 8-9 inches and 6-7 inches around.
Women also seem to favor thick or girth over length, a thicker penis will
stimulate the woman more by stretching her vaginal walls and creating more
friction. While men seem to be mostly preoccupied with length.
Let me say that being a Great Lover does not have much to do with penis
size. You can have a big cock and be a lousy lover or you could have 4 1/2
inches and be a Great Lover. What makes a great lover is the feeling and
passion that you channel through great sexual technique. I great lover is
more than a penis and knows how to use his eyes, his voice, his words, his
tongue, and his whole body as well as his penis. If you just happen to have
a big cock, so much the better.
Before I go on to the enlargement techniques, I would like to point out the
advantages and disadvantages of having a larger penis.
The Advantages of Having a Larger Penis:
Increased self-confidence and self-esteem.
Visually more of a turn on to your lover.
Looks good in the locker room.
Looks good in your pants.
May stimulate your lover’s vagina more.
The Disadvantages of Having a Larger Penis:
If your penis is very big (8+ long, 6.5+ around) some women may
refuse you intercourse.
If your penis is very long (8+ inches), it will hit the woman’s
cervix and cause pain, so you will have to thrust more carefully and not go
all the way in. Part of your penis (the first couple of inches) will get
left out in the cold.
If you penis is very long you will rarely get deep throated. If it
is very thick it will be hard for most women to put your penis in their
mouths. And if they can you may get hit by there teeth, if they don’t know
what they are doing.
If you are a fan of anal sex, the bigger you are the less chance
you will have of getting a woman to try it.
; If intercourse is difficult for your partner because of your size,
you may have sex less often.
Now that you know the long and short of it, Let’s move on to making it
bigger!
YES! YOU CAN MAKE YOUR PENIS BIGGER!
You may have ask the question can I make my penis bigger and depending on
who you asked you might have gotten back “No” or vague or unsatisfactory
answers or worse. Maybe someone looking to profit from desperate individuals
looking for an answer has even taken you advantage of. There are even mail
order companies that sell creams that claim to enlarge your penis or that
advertise “add three inches to your penis over night, with a prosthetic
enlargement device” making money off of people’s ignorance of the word
“prosthetic”, which means artificial replacement. So they sell you a fake
penis that fits on top of yours! How many people do you think will complain
to the Postmaster General that the Penis Enlargement Cream didn’t work!
Like I said in the Introduction of this manual, Yes You can enlarge you
penis if you are willing to make the commitment to do the proper techniques
on a regular and/or daily basis for an extended period of time. If you are
willing to make this commitment you can make significant gains in the girth
and length of your penis. The minimum amount of time that you should
consider is six months, however you will start to see gains before that
(individual results will vary). It’s like any other personal development or
skill that you learn, if you want a Black Belt in the martial arts, it may
take you 2-8 years depending on the style, If you want to get muscle and
look like a body builder it may take you a 6-2 years. If you want to have
the penis you always dreamed of and see results along the way, it may take 3
months -2 years. So in all of the above cases you can either bitch about how
long it will take and give and quit or you can make a commitment to your
goal and do a little work toward it every day and be for you know it you
have reached your goal and seen results along the way.
Warning: Because no two people are a like and you may have special needs,
all penis enlargement techniques should be done under the supervision of a
licensed Physician or Urologist.
Penis Enlargement Techniques
There are many different techniques to add both girth and length to your
penis. Some of them you might appeal to you and others might not. It also
depends on what your goals are.
Before we go any further go get a tape measure (The kind used in health
clubs and my tailors and a ruler. Now measure your penis first in the
flaccid (soft) state by putting the ruler on above your penis flat against
your pubic bone or the base of your penis and record the measurement. Next
take the tape measure and wrap it around your penis and record that
measurement.
Now stimulate yourself until you are as hard as you can get! If you are not
as hard as you can get your measurement will not be accurate. Now repeat the
measurement process as described above and record the measurements on one of
the sheets provided at the end of the manual. You can check as often as you
like during the program, but I recommend that you only record on the sheet
every month, as day to day measurement will fluctuate.
Now that you have your measurements let’s how you measure up to the average?
Erect Length: Erect Girth:
Small - less than 5" Less than 4 3/4" Circumference
Average 5" - 7" 4 3/4" - 5 1/2" Circumference
Large 7" - 9" 5 1/2" - 6 1/2" Circumference
Huge 9"+ over 6 1/2" Circumference
So where do you fall on the chart? Now that you know how big you are and
what is average, you need to decide how big it is that you want to be?
As with anything in life set reasonable goals for your self. If you are 4
inches don’t set your self a goal of 10 inches in length. I am not going to
say that it is impossible, but a more reasonable goal would be six inches if
you starting with 4. For length I would recommend that you go no greater
than 2" from where you are now. Try that out for a while and if you want
more than continue with the techniques. Also as for girth same rules apply,
however it is much easier to gain girth if you are using the Hyperemiation
technique. Again set reasonable goal and besides anything over 6 - 6.5 in
circumference is really BIG!
Methods of Enlargement
There are many methods and techniques of penis enlargement, some focus on
lengthening the penis, others focus on thickening the penis, and some do a
little of both. We are not going to cover all of the available techniques
out there, but rather the ones that we have found most beneficial and
proven.
Hot Compresses or Warm Water Soaking
Before any of the other techniques, this one should be done first, as it
will help to expand the blood vessels in the penis and increase the flow of
oxygen fresh blood in the penis, preparing it for the following techniques.
Now for the first step, either:
1) Wrap your penis in a washcloth filled with warm water.
2) Get in the bathtub and run warm water over your penis by putting your
penis under the faucet (test the water first with your hand, so you don’t
burn your self.
3) Soak In a Warm Bath.
Do any of these for 5-15 minutes. This will help to expand tissues of the
penis and bring in more fresh oxygen rich blood. After this step you penis
will have a pink hue and be slightly swollen.
Manual Techniques
The Jelq Technique or Milking the Penis
The Jelq technique is an ancient method of penis enlargement from the Middle
East. Traditionally it was taught father to son when the child reached
adolescence. In wealthy families the as the boy grow older he may be sent to
a “Mehbil” a gym or health club where a highly-train attendant will perform
the Jelq technique on the boy on a daily basis and as a result of these
daily treatments his penis grow to dimensions that it would not have
attained had he not used the technique. This technique also works on the
fully developed adult penis as well.
The Jelq Technique:
1. Start with flaccid penis; put some oil or lubricant on your hands and
penis.
2. Grip your penis with an overhand grip with your thumb and index finger.
3. Squeeze gently and milk your penis down to the head, stretching your
penis as you go. When you get to the head start the movement over with the
other hand.
4. Do the technique over and over again for 30 minutes alternating each hand
as you go.
5. If you start to get hard or feel the urge to ejaculate stop and wait
until it passes and your erection subsides a bit and then continue, as this
must be done with a semi-hard penis for it to work.
Tip: Make sure that you have more than enough lubricant on your hands and
penis. The best lubricant I have found is Albolene liquefying cleanser,
which can be found in the cosmetic section on most drug stores. Women use it
for removing makeup, but is also makes a great sexual lubricant(oil based,
do not use with condoms ever during sex). This product has been used in the
porn industry for years.
WARNING: You should use a moderate grip only.
If you squeeze too hard you could cause bruising and or rupturing of
superficial blood vessels on and near the surface of your penis. If after
doing the technique you see any red blotches or dots you used to tight a
grip have ruptured some superficial blood vessels and should wait until they
heal (Approximately 24-48 hours) before applying this or any other
enlargement technique.
You should do this 5-7 days a week for 30 minute each time. Don’t squeeze
too hard as you could bruise your penis. This techniques has worked for many
men, but it may take up 6 months before you see any noticeable difference
and most men will give up after 4 - 6 weeks.
What you are doing is forcing more blood into the corpora cavernosa (spongy
tissue of the penis) and over time they will stretch and grow to allow more
and more blood to fill the area, and henceforth you penis thicker. The
technique also over time stretches the tissues of the penis as well as the
suspensory ligament, which will help to lengthen the penis.
The Stretch Technique
The stretch technique is basically what it sounds like. By stretching the
penis 6 to 12 times a day you help to lengthen the suspensory ligament and
tissues of the penis which will help to lengthen the penis over time. Dr.
Walter Schlesingser M.D. first made a similar technique popular in his book
titled “Penicure, the Manhood Miracle”.
The Technique:
1. Your penis should be flaccid to slightly semi-hard.
2. Grip the head of your penis with your thumb and first three fingers, with
an over hand grip, the middle finger should wrap around just below the head
of the penis.
3. Gently and slowly stretch you penis as far as it will stretch without any
pain or discomfort. Hold for 15-30 seconds.
4. Repeat step 4 several times each session.
5. You should do this technique several times a day i.e. after urination, a
hot bath, a shower, before bed, or any other occasion that you have access
to you penis.
Taoist Exercises
The next couple of exercises are ancient Taoist techniques for giving the
penis a more pleasing mushroom shape and to produce harder erections. Both
of these are done with an erection. The first one is optional if you like
the shape of your penis.
Technique #1: To Reshape the Penis
This first technique is designed to give the penis more of a mushroom shape
and make the head larger which is said to heighten pleasure for the female
partner during intercourse.
1. Stimulate your penis until you have a very firm erection.
2. Grip the shaft of your penis with an underhand grip.
3. Squeeze firmly (but not hard enough to cause pain or to bruise your
penis).
4. Slide you hand up to the head, as if forcing blood into it. It is like a
milking motion. You should see the head expand and darken. Hold for a few
seconds, then release.
5. Repeat step 4 for 2-3 minutes.
Technique #2: To Strengthen the Penis and Produce Harder Erections
1. Stimulate your penis until you have a very firm erection.
2. Grip the shaft of your penis with an underhand grip.
3. Squeeze firmly (but not hard enough to cause pain or to bruise your
penis). Hold for a few seconds, then release.
4. Repeat step 3 for 2-3 minutes.
Techniques That Require Added Equipment
Hyperemiation or Vacuum Pumping
No doubt you have seen a vacuum pump be sold in the back of a men’s magazine
or in a sex shop hanging on the wall and thought to your self “I wonder if
it really works?”. Maybe you have even bought one and tried it with little
or no success. I am sure that many men have. I bought several and threw them
out when they did not work for me!
Vacuum pumps do work for some men, if used correctly and diligently over
time. The problem is the lack of information and instruction that comes with
the pump itself. In fact if you use the pump in the wrong way you could
actually injure your penis!
I know of many people including myself who have used Hyperemiation and
vacuum pumping to increase the thickness and length of their penises with
good results. It seems that an increase in thickness results much more
rapidly than in length. So if you are mostly interested in girth as that is
what most women prefer, then this is the technique that I would apply first.
There are a lot of Vacuum Pumps on the market today and some are just plain
junk others are very well made. You should get the best that you can afford
the prices range from $20.00 to $300.00 for an electric pump version, with a
good pump usually costing about $75.00. If this is out of your budget you
may opt for one of lesser quality and price. What ever the price, you should
get one that has hand pump with a pressure release valve on it that will
allow you to release the vacuum at will. There are some models on the market
that have a hole on the clear plastic chamber that you have to put your
finger over for the vacuum to work. I found it to be almost impossible to
pump and cover the hole at the same time; therefor I would avoid this type
of pump altogether. Also you don’t want to a pump with a chamber that is too
large for you. The chamber should be 1/4 inch to 1/2 inch bigger around that you
erect penis, but not big enough for the chamber to cover or go over you
scrotum.
What actually happens when you use a vacuum pump is that as you apply the
vacuum to your penis, the outer skin of your penis expands outward toward
the walls of the cylinder as this happens the deeper spongy tissue of the
penis (the Corpora Cavernosa and the Corpus Spongeosum) expand and fill with
blood and lymph fluid as they are being stretched by the vacuum pressure. As
the process is done over and over again for several months the spongy
caverns expand to a new larger size to accommodate the blood and lymph. That
is how the penis becomes larger.
The Vacuum Pumping Technique:
Things you will need:
1. A quality Vacuum Pump with a pressure release valve.
2. Pumper’s Lube or some other water based lubricant, such as Wet, Probe, or
Astroglide.
3. A tape measure.
4. A towel to clean up any spilled lube and to wipe off afterward.
The Actual Technique:
1. Now move to a comfortable position, preferably siting up or at a
45-degree angle. Generously lubricate the base and opening of the pump where
you insert your penis.
2. Lubricate you penis with the water-based lubricant and stimulate your
penis until your penis is either semi-erect or hard. And measure it with the
tape measure, both length and girth or circumference.
3. Insert your penis all the way into the clear chamber and close the
pressure valve.
4. Now this is where 90% of all men screw up. You want to create only a
moderate vacuum. If you over pump and create too strong a vacuum you could
burst blood vessels or cause lymph blisters on your penis. So you might be
asking, “how do I know what a moderate vacuum is?”. Here is a way that I
have found to work. First start pumping slowly until your penis stretches
and expands to its limit. The way you know the limit is that 1) it will feel
uncomfortable. 2) Your Penis will not stretch much farther. If your
semi-hard when you do this, you will see your penis stretch, however if you
are rock hard you might not even see it stretch. So when you have found you
limit and is seems a bit uncomfortable, release some of the pressure from
the release valve, until you are at a pressure that is comfortable, yet you
still feel a stretch.
5. Keep continuous a vacuum on for 30 min. After 30mins. you should release
the pressure completely, take your penis out and measure it. If there are
not any noticeable gain, you have not pumped long enough.
6. Massage you penis and area around the base gently for a minute, then you
may either stop keep pumping for another 30 minute session.
I recommend that for the first month you take it easy and just do 30 minutes
a day 5-7 days a week. After that you might want to pump for a longer
duration of 45 minutes - 1 hour or so. I have heard of men pumping for up to
3 hours. I personally have never gone over 1 hour myself.
The key seems to be a balance of vacuum pressure and time. The longer the
better with a moderate pump. The greater the vacuum pressure the greater the
risk of injury and blisters. You will have to find the right balance for
yourself, where you have adequate pressure for a duration of time 30 minutes
- 2 hours, that will give you the greatest gain without any injury. If you
do plan to go over and hour which I have never done and don’t recommend, be
sure to take 3-5 minute break every 30mins. To allow fresh blood into the
penis.
Tip: I have found that the Vacuum Pumping Technique is more effective if the
penis is erect during the session. While you will not be able to maintain an
erection through the whole session, I believe that you should start that
way, and try to maintain it for as long as possible. To aid in this I
recommend that you view some erotic material during the session, i.e. an
erotic magazine or video.
Also if you use the supplement L-Arginine an hour or so before the session
you will stay hard much longer. I have also have had good results by using
the maximum SAFE and COMFORTABLE ( it should not hurt or burn, if it does
the pressure is too great) pressure for a duration of 30-45 minutes while
sustaining an erection. It seem to work on the deeper tissues of the penis
more, when you have an erection as opposed to the external skin with out an
erection.
Repeat this technique on a daily basis 5-7 days a week if possible. Now for
the warnings.
WARNING: Use Only A moderate Vacuum Pressure!
1. Do not use too great a vacuum or you could burst blood vessels.
2. If you feel any pain immediately decrease or completely release the
vacuum pressure. You do not want to injure your penis! It’s better a small
penis, than one that is damaged.
3. In some cases a side effect of pumping and over pumping is that, the
opening of the penis gets deformed or changes shape a bit and when urinating
the urine will come out in a spray instead of a stream. If this happens,
stop pumping for (24-48 hours) and see if it goes back to normal. If it does
return to the normal state and you still desire to use pump technique, use a
lesser vacuum pressure. If you y still experience the side effect you will
have to determine if you want to continue with the technique altogether. But
as I said before this is generally a result from over pumping with too much
vacuum pressure and or pumping too often.
4. After your pumping session examine your penis and see if there are any
tiny red dots or red blotches. If you only see tiny red dots, you are using
too great vacuum pressure and have broken tiny superficial blood vessels in
your penis, which is for the most part harmless but overtime could give the
penis dark hue over the affected area. If you find any larger red blotches
you should discontinue use of the Hyperemiation treatments and any other
techniques until they completely heal. If there is any severe pain you
should seek medical attention.
The Program
I am going to share with you a program for penis development and enlargement
that has worked for many men including my self. The expected results are to
gain about an inch both length and circumference over 6-8 months. Individual
results will vary depending on how faithful to the program you are, your
body structure, and how regularly you do the program.
The program should be done 5-7 days a week. I think you will also benefit
from taking the supplements discussed earlier in the manual for producing
harder erections, because if you are not as hard as you can get you are not
as big as you can get.
The Program:
The following Techniques should be done 5-7 days a week. The Program
contains three parts, two of which can be done at different times of the day
or all at the same sitting.
Part 1
1. Do the hot compresses for 5-15 minutes, The closer to 15 the better!
2. Do the Jelq Technique for 30 minutes.
Part 2
1. Do the hot compresses for 5-15 minutes, The closer to 15 the better!
2. Do the Hyperemiation treatments for 30-60 minutes with a 1 minutes break
and massage of the penis at 30 minutes to allow fresh blood to enter the
penis.
Or
At One Sitting
1. Do the hot compresses for 5-15 minutes, The closer to 15 the better!
2. Do the Jelq Technique for 30 minutes.
3. Do the Hyperemiation treatments for 30-60 minutes with a 1 minutes break
and massage of the penis at 30 minutes to allow fresh blood to enter the
penis.
Part 3
1. Do the Taoist Techniques #1 and #2, upon rising in the morning on your
morning erection, or any other time you have a strong erection.
2. Do the Stretch Technique whenever you urinate or any time that you are
nude and your penis is flaccid. 10-12 times a day.
Attitude and Belief
Your attitude and belief regarding the techniques presented in this manual
are just as important as the actual techniques themselves.
I am not saying that if you don’t believe that they won’t work at all, but
they if they still do the results wont be a great as if you did believe in
them. This is the same principal that applies to patients in hospitals who
should respond to the medicine should recover and don’t because they just
give up or don’t believe that the treatment will work. Like wise there are
those who are given up on and make full recoveries, despite the odds!
They same applies here, if you use these techniques with the attitude, “It
won’t work for me, I never be able to last all night long! Or “This is
bullshit I am stuck with a 5 1/2 cock forever!” the results will respond
accordingly. How can you expect great success when you are planning for
failure!
The attitude you need to have is that it will work and, “I have a BIG COCK!”
and “I can last ALL NIGHT LONG!” Say it now! SAY IT OUT LOUD! And believe
it.
I am going to share with you the key to success in anything!
“What ever it is you want you have to feel as though you already have it!”
Read it Again.
“What ever it is you want you have to feel as though you already have it!”
What this means is that if you want a big cock you have to feel as though
you cock is already big. If you look down a feel disappointment that’s not
going to cut it. You have to feel that you have a great big cock!
Say I have a BIG COCK! Say it until you FEEL IT! In your gut, in your
spirit, in your soul, and then you will feel it in your body.
These are called affirmations, but for many years many people have tried
using affirmation with little or no results. They were doing them wrong;
they were just saying the words and not feeling them.
Some times when you say an affirmation another part of you gives or says a
negative response, that is why the affirmation does not work. You need to
deal acknowledge the response and then do the affirmation again. You have to
do this until there is no other response, except your intent to create the
desired result and your affirmation.
Here is the technique in step form.
The right way to do affirmations:
1. Define what it is that you want.
2. Have the intent to create it in your life.
3. Say it out loud with the intent of creating it.
4. If you here any mental noise or negative talk or response. Give it a
voice and say it out loud as well, get it out if your system, make it bigger
than life, really exaggerate it! When you are at the peak of exaggeration,
immediately commence with step 3 again.
5. When you can State your affirmation without hearing any mental noise or
other response and feel as though it is true, then you know there are
working and your life is bound for a change.
Visualize Your Goal
You should also visualize your Goal. See your self in your mind’s eye,
having the size penis that you desire. See how big it is when you
urinate. When you have sex and how pleased your lover is with your size.
Don’t think of it as something that is going to happen but as something that
has already happened or that always was.
What all of these mental techniques and exercises are doing is that they are
opening you up to new possibilities and actually opening your neural pathway
to give you the best results possible.
In conclusion
We at hope that you will benefit from the knowledge contained in this manual
and would like you to share your success stories with and let us know of any
improvement we could make to our manual. We would also like to hear of any
variation on the techniques that you might have had success with or any new
techniques that you may know about that we did not cover.
Thank you for taking the time to read the Penis Guide.
Please feel free to share this information.
First off, this work out DEMANDS your total devotion, and needs to be performed at least 5 times a
week. No exceptions. If you really want to enlarge your penis, you will make a good habit of
following this plan daily. I do it 6-7 days a week, but I have worked my way up to it. If at any time
you feel real pain or discomfort, ease up. There's no need to hurt your penis in order to enlarge it.
You will find after about 2-4 weeks, your penis will begin to feel and look larger and thicker, as well
as harder. First off, lets start by using a hot wrap:
The Hot Wrap: Take a wash cloth and soak under hot-warm water for several seconds, wringing
out excess water. Wrap around your penis and testicles and hold for several minutes. Repeat 2-3
times, making sure your penis is good and warm.
After you have Hot wrapped, dry of your penis well to ensure a good grip for the following
exercises:
1.) The Length Xtender: Making it longer!
This exercise I call the Length Xtender for obvious reasons. This exercise stretches your penis out,
stretching the erectile tissue. Your erectile tissue is kind of like your penis's central tendons that
engorge with blood, which give you an erection. While this exercise will lengthen your penis in its
flaccid and erect state, it will not thicken it as much as lengthen. I find this exercise much healthier
and safer than using weights for penis enlargement. This exercise should be performed sitting on
an edge of a chair or couch, but can be performed standing if preferred.
1. Make sure your penis is in its flaccid (limp) state. Take one hand and grip around the head of
your penis. Grip firmly, but not hard enough to feel discomfort. Take your other hand and grip
around the hand gripping your penis. This will ensure a firm and tight grip.
2. Pull out directly in front of yourself, pulling with enough force to feel a good stretch in your penis.
Hold and count for 30 seconds. Repeat 10 times, adding a little extra force each time, but not too
hard to cause pain.
3. Relax, and slap your penis against your leg about 75 -100 times to get the blood flowing again.
Rest for a minute.
4. Repeat step 2, except pulling to the left this time.
5. Repeat step 3.
6. Repeat step 2, except pulling to the right this time.
7. Repeat step 3.
8. Repeat step 2, except pulling up this time.
9. Repeat step 3.
10. Repeat step 2, except pulling down this time.
11. Finish by slapping your penis against your leg 75-100 times.
Next, Repeat step 2 as stated above, except this time rotate your penis in a circular fashion to the
left about 30 times. Now rotate your penis to the right about 30 times. Keep alternating left to right,
until you have completed this exercise about 5 times to each side. End by slapping your penis
against your leg 75 -100 times.
This exercise will ensure a longer penis within as little as 2 weeks, but within 3-4 months will really
be noticeable. We encourage you to take a notebook and log your measurements are each week.
This way you will know exactly what your progress is, and will also encourage you to keep up the
exercises.
This next exercise is called "jelq". Jelqing has been done for centuries by many tribes, cultures,
and as a family secret. Passed down from father to son for generations, it has been held in the
highest regard as the most effective method for enlarging your penis. This milking exercise forces
blood into the penis, repeatedly engorging the penis with blood. Over the course of several months,
the blood spaces in the penis becomes larger, being able to hold more blood, which in return
makes your penis larger. This exercise requires 20-30 minutes of your time, and should be
performed sitting on the edge of a chair, but may be done standing if desired. You will need a
teaspoon of Vaseline or a healthy dousing of baby oil to perform this exercise.
Note: Sitting vertical is better than laying down due to the fact that gravity will aid in your milking
sessions by keeping blood within your penis.
2.) Jelq - (Milking the Penis for Enlargement)
First, apply a generous amount of Vaseline, baby oil, or other lubricant to your penis and rub evenly
all over. Message your self to almost a full erection, but not quite. Now, message a small amount of
lubrication into your palms. Take your left hand and make an "ok" symbol with your thumb and
forefinger. Take your thumb and forefinger and grip tightly around the base of your penis. Keeping a
tight grip, slide your hand down to the head of your penis, pulling as you go.
You should watch the head of your penis expanding as you slide your hand down. Repeat with your
right hand. Now continue this act over and over, one hand then the other in a sort of "milking"
action. Be sure to keep a tight grip around your penis with your thumb and forefinger as you milk
down to your head, watching your head expand with blood as you repeat, one hand then the other,
over and over again at a medium to brisk pace.
While milking, do not ejaculate. If you feel the urge to ejaculate, pause milking for a few moments
and wait for the urge to subside. Holding back is an exercise in restraint, which will instill a sense of
self-control. This milking stimulates circulation in the genitalia, and the increased blood supply is
temporarily trapped in your penis. After several months of milking, your penis will begin grow longer
as well as much thicker. You will probably notice a change after the first couple of sessions.
After about 3-4 months of daily practice, results will become permanent, but we encourage you to
continue Jelq sessions to keep your penis in its utmost prime shape. For the first week or so, only
jelq for about 10 minutes per day, or 100-200 repetitions. After a week or so, try to work up to 20
minutes every day.. Really add some force (not too much though, a moderate grip will work best)
while you milk. Remember, keep your penis in a half-erect state. If it's totally limp while you milk,
you will not see any results. You MUST have a partial erection while doing this exercise.
After about 2 weeks, work yourself up to jelq sessions that last 30 minutes or so. Within a 3-4
month period you will be writing us to say how much you love this manual, we guarantee. This
exercise is perhaps the most effective penis enlargement technique known to man. It not only
makes your penis longer and thicker, but harder and over all healthier as well.
After you have had a 30-minute jelq session, your penis should feel warm, larger than normal, and
tingly. This is the feeling that you want because it shows that you have broken down and fatigued
your erectile tissue in your penis, and it will grow back bigger and stronger, similar to body building.
If you cannot achieve an erection for several hours after a vigorous milking session, do not worry
because this is quite normal. Your erectile tissue is just extremely tired, and will recover shortly.
Remember to keep your hands to the side of your penis, and your thumb over the top and your
index finger under while you grip your penis to perform the milking exercise.
After your jelq session, perform another "hot wrap" with a wash cloth to stimulate your penis and
keep blood held within.
This next Exercise is a true sex secret. Its called The PC Exercise, and it just may save your
life one day by helping prevent prostate cancer, as well as give you rock hard erections, and enable
you to ejaculate further than you ever dreamed. It will also give you incredible power to hold back
the urge to ejaculate until you feel the desire to. No more "minute man" syndrome.
4.) Kegel's - The PC Exercise
This next article was emailed to me by an anonymous source, but has had a HUGE impact on
thousands of men's sex lives as well as overall well being.
Would you like to know an exercise that can restore a youthful erection, help to create mind-blowing
orgasms (solo or with a partner), and even save your life by giving you a healthy prostate...?
PC exercises, also known as Kegel exercises, strengthen the pubbocoxygennus muscle (PC
muscle), a sling of muscle that surrounds your anus and prostate gland. The PC muscle is the
muscle that involuntary "pumps" when you ejaculate. Strengthening - and learning to control - this
muscles is THE sex secret. Maybe it sounds too good to be true, but there's now a simple, foolproof
way for men to boost their partners' and their own pleasure during lovemaking. And it doesn't rely
on aphrodisiacs or drugs. Instead, it involves doing a set of easy to learn pelvic-muscle exercises
called Kegels (after Arnold Kegel, M.D., the gynecologist who developed them over 40 years ago).
Women have been practicing these moves for years to intensify their orgasms and increase their
partners' stimulation. Now, sex therapists and researchers have discovered that both partners can
benefit sexually when men do Kegels too.
Time-honored Taoist healing techniques refer simply to "tightening the anus."
First, locate it. Stop the flow of urine when you take a pee. If you have trouble doing this, you really
need these exercises.
PC clamps: squeeze and release your PC muscle. Start with a set of 20-30, and work your way up
to sets of 100-200. Do at least 300 EVERYDAY, for the rest of your life. This will give you an
erection harder than when you were a teenager. Continual practice will ensure you a rock hard
erection, any time you desire, as well as giving you the ability to actually hold back your orgasm as
long as you desire simply by flexing your PC muscle.
Long squeeze: hold PC muscle clamped tight for a count of twenty... or as long as you can.
Stair steps: tighten and loosen in increments.
PC flutter: tighten the PC muscle as slowly as you possibly can. At some point it will "flutter," and
you'll feel energy sparkling up your spine. Concentrate on deep, slow breathing while you do this great for restoring energy when you're running down!
Kegel exercises both strengthen and tone the pubococcygeal (PC) muscle-which runs from front to
back in men's and women's pelvises--as well as the surrounding pelvic muscles. The PC muscle is
what helps bring a man or woman to climax, and, along with other pelvic muscles, it also controls
urination.
In his recent book, "The New Male Sexuality (Bantam Books, 1992), psychologist Bernie Zilbergeld,
Ph.D., claims that many of his male patients who practiced pelvic-muscle contractions over time
reported increased sexual sensation and more intense orgasms. That's not all. Over the past 20
years, William Hartman, Ph.D., and Marilyn Fithian, Ph.D., co-directors of the Center for Marital and
Sexual Studies in Long Beach, California, have prescribed Kegel exercises to more than 1,300
male patients who were troubled by erection problems. Most of the men who did the exercises as
prescribed reported firmer erections than before.
What's more, nearly 200 of Dr. Hartman and Dr. Fithian's male patients who practiced Kegels
learned to delay ejaculation, enabling them to prolong sex to their own and their partner's
satisfaction. And most surprising, 10 percent of these men were eventually able to have multiple
orgasms--that is, two or more climaxes during a single act of intercourse before ejaculating.
(Orgasm and ejaculation don't always occur simultaneously in men.)
With so many sexual benefits, Kegels are the perfect "sexercises" for men as well as women to
master. Besides helping to create the physical conditions that enhance lovemaking, the exercises
can spice up sex in another way as well. "Partners can take turns tightening their pelvic muscles
during intercourse," explains Dr. Hartman. "Each will feel the other's muscle contractions, which
adds to the excitement."
For a man who wants to learn how to perform Kegels, the first step is locating the PC muscle.
Here's how: Some time when he has the urge to urinate, he should sit on the toilet with his legs
spread, start to urinate, then try to stop the flow. (The PC muscle is the one he squeezes to do
this.) After restarting the flow, he can practice stopping and restarting the stream of urine. It may
take several attempts to actually isolate the PC muscle--the buttocks muscles have a tendency to
kick in if the legs aren't kept wide. When a man has familiarized himself with the sensation of
contracting the PC muscle, he's ready to practice holding the contractions. He should first try
holding a contraction for several seconds three or four times a day. Over the next few weeks, as he
continues doing Kegels, he can gradually increase the time of the contraction until he is holding it
for 10 to 15 seconds. Next, he should alternate these Kegel holds with a series of short, quick
contractions. Dr. Hartman recommends that men gradually work up to a daily routine of 100 quick
PC contractions and five holds. (Women who want to learn how to do Kegels should follow these
same steps, but they only need to do the long holds for five seconds; men, however, need the 10to 15-second hold for delaying ejaculation.)
After a few months of diligent practice, a man should be ready to try using the Kegel hold during
intercourse to delay ejaculation. But first he must familiarize himself with the sensation known as
ejaculatory inevitability--the point at which he can no longer hold back an ejaculation. He will feel an
uncontrollable urge to ejaculate as his prostate gland and seminal vesicles contract. Once a man
has developed an awareness of this sensation, he can then learn to produce a PC contraction
before he reaches that point of no return. (Another option is for a man to try practicing this
technique on his own while masturbating.)
Most men can do Kegels anywhere, since they're seldom aroused by the exercises; women may
want to practice Kegels in private since for them, the increased blood flow to the pelvic region is
more likely to spark arousal. Continued over a lifetime, the exercises can help men (and women)
head off urinary incontinence later in life. That plus greater arousal, enhanced orgasms and longerlasting sex make these some of the simplest, most beneficial exercises a man or woman can do. I
do at least 5 sets of a hundred every day, and some days I even go for 10 sets.. This exercise,
without a doubt, can increase your sexual performance 10 fold.
Now that you know how to do the exercises, let’s begin our workout plan.
Please follow all 4 steps.
1. Begin by gently stretching your penis out by grasping around the head and pulling outward, then around in
a circular rotation, left then to the right. Do this for about 5 minutes. This is the Length Xtender workout.
Eventually you can work yourself up to 30 minutes of this exercise, but that’s after you’ve been doing this for
at least a few months. This will lengthen your penis over time by stretching the center tissue out longer. After
about 5 minutes of warming up, proceed to #2.
2. Time for Jelq. A generous amount of Vaseline is needed for this exercise, about a teaspoon full. Rub the
lubrication all around your penis, messaging yourself to a partial erection. Take the excess Vaseline and rub
into your palms. Now take your index finger and thumb and grasp around the base of your penis, grab firmly
and "milk" forward until you come to the head of your penis. Repeat with the other hand, and do this over
and over at a medium pace, really concentrating on your head expanding as you milk forward. Do this for 15
minutes starting out. After one week Jelq for 20 minutes. After 2 weeks Jelq for 30 minutes at a time. By the
third week you will start noticing a difference in your length and especially in your thickness. After you have
jelqed continuously for your appropriate amount of time, move on to exercise #3.
3. Kegels. This exercise is explained in the first part of the manual, so if you can’t remember how to do them,
please revert to the beginning of the manual. Hold a PC flex for as long as you can, do this 5 times to warm
up. Now do a set of 50 kegels, taking a 30 second brake after the 50 have been achieved. Do 4 sets of 50
kegels starting out, every day after you jelq. Many men also get into the habit of doing kegels while they
drive, work, etc. Kegels are the most important exercise to do for overall sexual performance. After a week of
this regimen, do a set of 100 kegels at a time. Over a period of a month or so, you should be able to do 200300 kegels at one time. Do 4 sets of these a day, and within a few months you will be able to hold off the urge
to ejaculate for as long as you want, and will also be able to keep an erection after you have ejaculated. This
exercise truly is the "sex secret".
4. Finish with a Hot wrap. Soak a wash cloth under a hot faucet and wrap around your penis and testicles. Do
this 3 times, and finish by drying with a towel.
Do this workout plan every day, taking 2 days off every month. We guarantee results! They will come!
DO THEM EVERY DAY. We guarantee you will be emailing us with a great success story in no time
at all. Give us a chance at making your life better.
Performance Enhancing Exercise:
Glute Flex's:
Lie on your back and tense your buttocks. Flex your buttocks 5 times with a 3-second delay before unflexing.
If you feel even a slight burn, then you are very out of shape. This is where most of your thrusting force
comes from where sex is concerned. Your buttock holds most of your thrusting power and stamina, with your
abdominal being second in line. Here's the Flexing exercise from start to finish:
Lie on your back, and make sure you are on a floor, or firm surface so that you have the appropriate
resistance to force against (i.e., the carpet, floor, etc. Your bed is far to giving and will not work for this
exercise.).
1-Flex your buttocks as hard as you can, holding for a slow 3 count, then unflexing. Do these 5 times to warm
up.
2-Flex and unflex in a fast, steady pace for 3 sets of 50, or if you can't even do 50, do as many as possible.
rest for 30 seconds between each set, and take in deep, slow breaths through your nose, and exhaling through
your mouth.
3-Next, flex as hard as possible and hold for as long as you can until you start to tremble. Once trembling,
unflex and repeat 5 times..
4-Repeat step 2.
5-Repeat step 3.
6-Finish by doing very rapid flexes continuously for 30 seconds or as long as you can.
7-Sit up and rest for several minutes.. This exercise will give you flex power and will increase your thrusting
10 fold after several weeks of exercising. They should be performed 5 days a week, for the rest of your life.
This will also tighten and shape your buttocks, which will also be more appealing to your lover.
Introduction
The techniques and exercises in this manual are recommended by doctors world-wide. I am not
responsible for misuse of this product.
It is the responsibility of the user to thoroughly read the safety, warm-up, warm-down
procedures prior to beginning this program.
The exercise techniques, if used improperly can damage the penis. The Resource Manual clearly
indicates any possible safety issues that may arise while using these techniques.
By utilizing these techniques and continuing forward in this manual, you declare that you have
read this legal notice and do not hold penilespecialists.com or their parent company(s) liable for
any damages incurred while using this product.
Your penis is divided into three chambers which are made of a spongy tissue. This tissue
absorbs blood as it rushes to the penis, creating an erection. If you can perform the right
exercises, these three chambers will gradually expand and eventually be able to hold more
blood. This creates a larger Penis!
The key to growing the penis is expanding the erectile tissue.
When you first engage in penis enlargement your flaccid size will increase rapidly for about the
first 1.5 inches. At this same stage you will gain roughly 1 inch in erect size. So, in the
beginning you'll gain 1.5 inches in the flaccid state and 1 inch in the erect state. The rate and
overall effectiveness of Enlargement, however, depends on numerous things like your
physiology and current size.
For example, if you are currently 7.5 inches, your penis will probably not grow 3 inches to 10.5.
If your erect penis is currently 5.0 inches, then expect that it will be around 6.5 inches within
about 90 days!
Firstly, read through this manual carefully and make sure you understand each exercise. Once
you've found the techniques that you're comfortable using, stick with them. Here are a few tips
before you get started.
MAKE SURE YOU MEASURE YOUR PENIS FIRST...
FLACCID: Get a ruler and place it over your penis. Then Push the ruler back into your
abdomen as far as it will go. Hold your limp penis along the ruler and measure to the tip of the
head.
ERECT: While standing, gently angle your erect penis until is is parallel to the floor. Press the
ruler against your pubic bone (just above the base of the penis) and measure from top to tip. It
may be easier to measure by standing with your knees locked and grabbing the penis from the
bottom, just behind the head on either side. Press ruler against your pubic bone, and measure
on top of penis as you pull it out as far as you can. Try moving your pelvis or changing the
angle to see what variations can occur during this type of measurement. Once you've figured
out how to measure to get the same result as your erect length, you will find that this
measurement is easier and more convenient than measuring your actual erection.
GIRTH: With a piece of string or cloth measuring tape, measure the circumference of your erect
penis at mid-shaft.
CUT YOUR PUBIC HAIR: Not only does this make your penis look bigger, but it helps when
you're doing some of these exercises. When stretching, pulling and "milking" your penis, you
don't want to be pulling your hairs out!
EAT HEALTHY AND TAKE VITAMINS: In order to eliminate any possibility of slow growth,
make sure you're getting an ample amount of nutrients. The proper levels of minerals, amino
acids, and vitamins DO have an effect on the workout process. Also, drink lots of water!
MOST IMPORTANTLY, HAVE A GOOD STATE OF MIND: Your mentality has a lot to do with
the growth of your penis. If you don't believe that enlargement will work, it's very likely that
your subconscious will make it more difficult to physically grow the penis. A positive attitude is
essential.
As we've said, these exercises demand COMPLETE 100% devotion. You MUST perform them 5
DAYS A WEEK. If at any time, though, you begin to feel discomfort or pain, take a little time off.
You only want to enlarge your penis, not hurt it.
Remember, by applying tension, pulling, pressure, stretching, or expansion to a penis you are
creating a force which will spit the cells in the penis. You want to be sure to split the cell and
break it down just enough to ensure structural balance on a SAFE level as to allow for the
normal healing processes. By forcing the division of too many cells, because of too much
pressure, you are creating ugly healing which will create a distorted penis, possibly with no rate
of gains. So again we stress... DON'T OVERDO IT!
If performed correctly and routinely, you will soon begin to see the results you hope for. Within
the first few weeks or so, your penis will actually start looking LONGER AND THICKER. That
should be all the encouragement you need to keep up with your daily exercises!
When performing the jelqing exercise, you will need to apply a lubricant on your penis.
Do NOT use soap or shampoo! These can irritate the skin when applied so vigorously and for so
long to the skin. It can also dry out the skin severely, causing it to crack and peel for a few
days. Furthermore, it can sting if it gets into the hole (the urethral opening) at the end of your
penis.
Vaseline (Petrolium jelly) works, but.. be forewarned.. it's greasy and makes a mess. Another
downside is that Vaseline is so thick, it may not allow you to move your hand as fast as you'd
like.
Baby Oil also works, but it is also very messy and leaves stains.
One of your best bets is using Vaseline Intensive Care. It cleans up fairly easily, is slippery, it
lasts long, and lets you go as fast as you want when performing the exercises.
Be aware of when and when not to engage in penis enlargement. You should consult a
urologist if you have a disease which may alter blood circulation, oxygenation, and
regeneration of tissues which exists under the conditions of advanced diabetes,
respiratory instability, and cirrhosis. As you're doing your workout, here are some
symptoms to be aware of:
Blisters are a result of too much pressure on the penis for a prolonged period of time. You want
pressure, but don't overdo it!
Red sores are a result of too much stretch. In order to avoid this, hold off on your exercises
until the blisters have disappeared.
Nerve inflammation is caused by using too much weight, too often, for too long of a period. This
will distort the nerves within the penis and cause them to swell. If the swelling continues, then
atrophy might occur. This means you won't be able to get an erection again.
"Fuzzy skin" is a result of tissue abuse. When you touch this affected area you can actually feel
its fuzziness because it's directly external. This is the partially dead tissue covering your penis.
This can happen when too much tension is applied. Red sores sometimes accompany fuzzy
skin.
That being said, the exercises we're about to discuss are all healthy natural ways to produce
penis growth. Just use good sense when performing them. We recommend a Daily Workout
which should be performed 5 days a week, but if at any time you begin to feel real pain or
discomfort, ease up!
You should begin your daily workout with this procedure. This is not really an exercise,
so much as a prerequisite. What the hot compress does is draws blood to the area of your
penis, increasing the blood flow and making the skin slightly elastic. This also ensures a
good grip for the exercises you will be performing.
Soak a washcloth in warm-to-hot water, then wring out. Take the cloth and wrap it around the
shaft of your penis (either flaccid or erect). Hold it there a minute, then repeat a couple of times.
Dry off your penis well.
After the Hot Towel warm-up, proceed to perform a stretching exercise. Squeezing and pulling
your penis on a regular basis can produce incredible size gains, just as exercising muscles will
make them larger. These exercises stretch your penis out, while also stretching the erectile
tissue. These are the exercises for lengthening your penis in its flaccid and erect state. Choose
ONE of these stretching exercise techniques to include in your workout.
TECHNIQUE ONE
If you really want to enlarge your penis, this is the technique men swear by. You can perform
this either standing up or sitting down.
1. With the penis in its flaccid state, take one hand and grip firmly around the head of your
penis. Be careful not to cut off too much circulation.
2. Pull your penis out directly in front of yourself. Stretch it as much as you can without
causing pain or discomfort. Hold it there for 5 minutes. After each minute, pull it out slightly
further each time.
3. Relax for one minute. "Twirl" your penis in a circular motion about 30 times. This gets the
circulation flowing again.
4. Repeat Step Two again 4 times, except pull your penis in a different direction each time... up,
down, to the left, and to the right. After each 5 minute pull, repeat Step 3.
5. After you've completed 5 pulls (5 minutes each), pull your penis out directly in front of you
one more time. Give it a good 1-minute stretch and 10 slight "tugs" outward, not jerking too
hard.
Stretching the penis with your hand produces the same results as traditional penis weight
systems. The best way to use your hand is by applying most of the pressure anywhere else
except on the dorsal nerve, which is that thin nerve that runs along the top of the penis. There
is nothing wrong with designing your own way of gripping your penis, as long as you know
where and where not to apply the wrong pressures. Again, DON'T HOLD TOO TIGHT, otherwise
you'll cut off the circulation.
This exercise will ensure a longer penis within as little as 2 weeks, but within 3-4 months will
really be noticeable.
TECHNIQUE TWO
This technique is very similar to technique one. It's been posted on web-forums several times by
men who say they've added up to 2" to their penis!
1. While in its flaccid (limp) state, take one hand and grip around the head of your penis. Grip
firmly, but not hard enough to feel discomfort or cut off too much circulation.
2. Pull out directly in front of yourself with enough force to feel a good and painless stretch in
your penis. Hold and count for at least 30 seconds to one minute and rest.
3. Then continue doing this until you've logged in 5-20 minutes of stretching for one session.
Take a 10-20 minute break after each session.
TECHNIQUE THREE
This is one of the ancient sexual secrets. It involves stretching the penis in both flaccid & erect
state. As is the case with most of these Ancient methods and healings, it is a little esoteric and
describes some practices that may be unfamiliar to you. But for purposes of this manual, we
will print the technique as it is described in the Taoist teachings:
Inhale the air through your nose into the throat, then swallow and press it down to the
stomach. When the air reaches your lower abdomen, press it into the penis itself. Take the 3
middle fingers of your left hand and press them to the Hui-Yin midpoint between the anus and
the scrotum. This lodges the power in your penis. Resume normal breathing, still keeping the
left fingers at the midpoint. With your right hand, begin exercising the penis by pulling it
forward & backward, stretching it out in a smooth rhythmical motion 36 times. Use your
thumb to rub the glans of the penis until it is erect. With your right hand, circle the penis
firmly at its base. Still holding firmly, slide your hand forward an inch. This locks the air energy
into the penis, pushing it toward the head. Pull the penis out to the right, then rotate with a
stirring action 36 times clockwise and counter- clockwise. Then pull the penis out to the left
and do the same. The energy of many of your body organs flows into the penis, which enhances
its tone and function. Complete the exercise by gently beating the inner right thigh with your
erect penis 36 times, then beat the inner left thigh 36 times.
TECHNIQUE FOUR
This version of stretching appears in a bestselling book on male sexuality. It also involves
stretching the penis in both its flaccid and erect state. This seems to be just a slightly modified
version of the Ancient technique listed above (Technique Three).
1. With your right hand, grip the penis and rhythmically pull it forward and away from your
body 10 times (roughly 15 seconds each pull).
2. Repeat to the right (10 times), to the left (10 times) and down (10 times).
3. Rub the head of your penis with your thumb until you get an erection. Circle the penis at its
base with your thumb and forefinger. Pull forward an inch (10 times) to force energy into the
head.
4. Pull the erect penis to the right and rotate in small circles while pulling outward (10 times).
Repeat to the left (10 times).
5. Gently slap your erect penis against inner thigh while pulling out on each side (10 times).
JELQING (also known as "Milking") is an "ancient" technique that has been performed for
centuries by many tribes and cultures. It is considered THE most effective method of penis
enlargement.
These milking exercises force blood into the penis. Over the course of several months, the blood
spaces in the penis became larger, which means that they can hold more blood. This in return
makes your penis larger.
We have found that there are SEVERAL different variations of Jelqing that are practiced by
men. The general notion of "milking the penis" is always the same, but the techniques seem to
vary a bit. Our personal preference is TECHNIQUE ONE. We've had more success growth-wise
with our clients with this particular technique. Read through all the different variations on
Jelqing and decide which technique you think would work for you.
You will want to use a lubricant for these exercises.
The results from Jelqing are PERMANENT. The penis will become enlarged in both the flaccid
and erect states, but especially in its erect state. The exercises are beneficial, not harmful. They
will actually improve the health and strength of the male organ as well as increase its size.
IMPORTANT: Care must be taken that the exercise is NOT PERFORMED DURING HARD
ERECTION. Vascular (vein) damage could result if the penis is forcibly milked in its fully erect
state. You want your penis between half to 3/4 erect. Results cannot be obtained until a partial
erection is present. After this exercise has been performed, it will be noticed that the penis
(even in its flaccid state) appears both longer and thicker. This is a fact. And from within one to
several months of exercise, the penis will appear rather enormous; this is due to the impaction
of blood in the penile tissues. Choose ONE of these jelqing exercise techniques to include in
your workout.
This simple exercise, if practiced five days a week, will enable a man who possesses, for
example, a six-inch erect penis, to add from between one to three inches to the length of his
penis (measured at the top, from tip to pelvis) and it will grow in circumference proportionately.
Little or no growth may be apparent for approximately one month. During the second or third
month an increase of two or more inches will not be uncommon.
TECHNIQUE #1
1 - When your penis becomes SEMI-ERECT, make the American "A-OK" sign with the thumb
and forefinger of your left hand. With this hand, grip tightly around the base of your penis.
2 - Now starting from the base, pull the penis gently but firmly. Stretch downward and
outward. You should still be in a semi-erect state. Make sure to touch the penis all the way
from the base to the head. Note that the head of your penis expands with blood.
3 - Switch to the right hand and do the same thing, starting from the base and stretching
downward to the head. Alternate both hands in a smooth rhythmic ("milking") motion, touching
upon every part of the penis except the very top part of the penis head.
Do 200-300 strokes/day at medium strength for the first week. (10 minutes)
Do 300-500 strokes/day at medium-full strength for the next week. (15 minutes)
Do 500 or more strokes/day from then on, and as strong as you can make them. (20
minutes)
If you find yourself getting an erection during this exercise, squeeze harder to discourage it or
simply wait until it subsides. You can encourage circulation afterward by slapping your penis
up and down 25 - 50 times. Perform this exercise 5 days a week. Remember to keep your penis
only partially erect. If you feel ejaculation coming on, pause milking until the urge subsides.
This is itself an exercise... one of self-control.
TECHNIQUE #2
1 - Apply lubrication to the flaccid penis from the hilt to the head.
2 - Using only the thumb and forefinger, stretch the penis downward and slightly outward. Be
gentle, but firm.
3 - Alternate hands, one then the other, in a "milking action".
4 - Keep performing gently until a certain amount of swelling develops, then perform the action
a bit more firmly and forcibly.
5 - Repeat this action 100 times.
For the first ten days, take it relatively easy. Gradually though, you should be performing
200 repetitions. These exercises are the same for both circumcised and uncircumcised
men. It will be noticed that the head (or glans) becomes extremely red and that it will
swell considerably. This is normal and good, and is due to the forcing of blood to that
area.
TECHNIQUE #3
This is the "Dry" version of Jelqing. Similar to Techniques 1 and 2, but without the lubrication.
In "dry" milking, you squeeze and pull the skin, but you don't slide your fingers over the skin.
As the penis becomes too large to cover in one stroke, work on the base and middle of the shaft
separately.
Some guys like to milk "dry" in the morning before getting out of bed (when testosterone levels
are the highest.) If you find your penis is getting sore, take a day off.
TECHNIQUE #4
Apply lubrication to your penis, rubbing all over. With your penis in a 1/2 state of erection, rub
a little more Vaseline into your palms. Take your left hand and make an "ok" symbol with your
thumb and forefinger. Then take your thumb and forefinger and grip tightly around the base of
your penis. Keeping a tight grip, slide your hand down to the head of your penis, pulling as you
go (the head of your penis expands as you do this). Repeat with your right hand, and continue
over and over, one hand then the other. Keep this movement going at a medium to fast pace.
For the first week or so, only jelq 100-200 repetitions (about 10 minutes). After the first week,
try to work up to 20 minutes each day. Remember to keep your penis only partially erect. If you
feel ejaculation coming on, pause until the urge subsides.
TECHNIQUE #5
This is also known as the Tao technique. This works for men who want a bigger "mushroom"
head on their penis. It's essentially the same as Technique One, except performed slower and
more gently.
Use your fingers to push the blood up to your penis head and create some sustained pressure.
Hold that position momentarily (approximately 10 seconds.). This will expand the capacity of
your head to take in more blood, in the end creating a bell or mushroom shape. You can also
squeeze the shaft to make the blood engorge in the head. Once it's hard, you can release the
squeeze. Repeat as many times as you wish (but don't exceed 10 minutes).
Introduction to the PC Muscle
In researching this manual, time and time again we came across resources mentioning the PC
Muscle. Performing These exercises are most IMPORTANT for several reasons: they give you
stronger erections, create intense (sometimes multiple) orgasms, help you control your
ejaculations, help shorten the recovery time between orgasms, and even give you a healthy
prostate. The PC muscle (or pubococcygeal muscle) is actually a group of pelvic muscles that
form the basis for your sexual health. They run from your pubic bone in the front to your
tailbone in the back. You can feel this muscle at your perineum, just behind your testicles and
in front of your anus. In addition to controlling urination with other pelvic muscles, the PC
muscle is what helps bring a man or woman to climax. For men, this is the muscle that
involuntarily "pumps" when you ejaculate. Strengthening and learning to control this muscle,
you will find, is THE sex secret.
These PC exercises involve doing a set of easy-to-learn pelvic-muscle exercises. This is a
FOOLPROOF way for men to boost their partners' and their own pleasure during lovemaking.
Women have already been using their PC muscles for years to help them get sexually aroused
easier, lubricate faster, and have more and better orgasms.
First you must Locate Your PC Muscle. It's actually easier for men to locate this muscle and do
these Exercises than it is for women. Simply stop your urine midstream when you urinate. This
not only teaches you how to find the PC muscle, but gets you started on your exercises. Stop
and restart your urination 5 times during every trip to the bathroom. Using your ability to stop
the flow of urine will help you control your ejaculations.
Ancient techniques refer to this process simply as "tightening the anus". You can flex the PC
muscle quickly and repeatedly, or clench tight and hold for as long as you can. This latter
exercise is tougher than it sounds, yet this is the exercise that the sex gurus say will help you
prolong your erections and increase the force with which you ejaculate.
Once you've found your PC muscle, you can start doing the PC Exercises anytime,
anywhere. You want to squeeze your PC on a daily basis. These are the PC Exercises:
Perform quick PC CLAMPS. Squeeze and release, over and over. Start with sets of twenty,
then build to 100 or more. Do at least 250 PC clamps every day, for the rest of your life. Your
goal is to be capable of creating 1,000 clamps a day.
Practice LONG SQUEEZES by holding the PC muscle clamped tightly for thirty seconds, or as
long as you can.
Try doing STAIR STEPS: tighten and loosen in increments. Tighten for a couple of seconds,
loosen for a couple of seconds. Do it over and over again.
PC FLUTTER: Tighten the PC muscle as slowly as you possibly can. Once you've finished the
slow squeeze (to where you can't squeeze anymore), let go. At some point it will "flutter," and
you'll feel energy sparkling up your spine. Concentrate on deep, slow breathing while you do
this. This is great for restoring energy when you're running down!
When you urinate and you want to let those last squirts shoot out, you use your PC muscle
in the other direction. By doing this you'll feel your anus open and the sensation is different.
This is called the PUSH OUT PC.
Most men can do Kegels anywhere, since they're seldom aroused by the exercises.
Continued over a lifetime, the exercises can help men (and women) head off urinary
incontinence as they get older. That, plus greater arousal, enhanced orgasms and longerlasting sex, make these some of the simplest, most beneficial exercises a man or woman
can do.
Psychologists and sex experts have prescribed Kegel exercises to thousands of male patients,
many of whom were troubled by erection problems. Most who did the exercises reported firmer
erections than ever before. Others reported increased sexual sensation, more intense orgasms,
and the ability to delay ejaculation. And most surprisingly, some of the men were eventually
able to have multiple orgasms! That is, two or more climaxes during a single act of intercourse
BEFORE ejaculating!
Massage & Warm-down
This is how you should end your workout, as applying heat and massage optimizes healing.
Your testicles are always trying to maintain a 34 degree temperature to keep the cells alive.
Heat restores any nerve and sensitivity problems you may have incurred during your
enlargement program.
After your workout, gently massage your penis for several minutes. After massage, you can
either apply another hot towel as you did at the beginning of your workout, or you can place
your penis in a bowl of lukewarm water for a another few minutes. Either of these "heat
applications" will keep the blood held within your penis and stimulate the damaged parts,
restarting them to function better. Dry off well with a towel.
Workout Introduction
Now that we've explained each of the exercises, it's time to apply them in a daily workout
program. This, men, is the moment of truth! If you really want a LARGER PENIS, you
MUST perform these exercises as explained. These are VERY POWERFUL methods that
have been PROVEN! They've worked for us, they've worked for thousands of clients, and
they've worked for hundreds of thousands of men throughout history! So believe us when
we say.. THEY WILL WORK FOR YOU!!
This is OUR suggested Workout Program. You MUST do this program for ONE HOUR EVERY
DAY, 5 DAYS A WEEK. Be sure to take 2 days off a week (consecutively or not), as this is your
"healing" time when your cells rebuild after they've been broken down. Do this, and you should
start seeing results within the next 3 weeks. Once you witness this penis growth for yourself,
you won't want to stop this program, nor should you! Remember... Knowledge, Commitment,
Growth. These exercises have been designed not only for penis enlargement, but also for a
better self-esteem and personal satisfaction.
NOTE:
For this workout, we have included OUR recommended techniques for the exercises you have
just read about. If you think you'd like to try one of the other techniques, go ahead and do so.
But whichever techniques you decide to use, make sure you stick with them and give them a
chance to work. If after a month you find that one of the exercises isn't working for you (which
is rare!), then try a different technique. Always refer to the instructions for ANY of the exercises
whenever you need to.
Maintaining a Hard Erection
These tips will help you achieve longer lasting & harder erections:
Stick to a low-fat, high-fiber diet. High levels of cholesterol can actually clog the blood vessels in
your penis. This also can cause impotence. Furthermore, you should include a little zinc in
your diet. Foods containing zinc include lean beef, turkey, cereal, lamb, crabmeat and oysters.
Make sure you get plenty of exercise. When you're out of shape, not only does this negatively
affect your ability to have sex, it increases the likelihood of erection problems.
Stop smoking. Besides the obvious health risks of smoking, studies show that smoking plays a
major role in erectile & impotence problems among men.
Finally, the best piece of advice that can be given (and one you probably won't have any
problem with) is this: If you want to have better erections- Have MORE erections! The muscle
tissue in your penis needs oxygen to survive. Where does it get that oxygen? From the red blood
cells flowing in the blood. The more blood that circulates, the less chance of erectile failure.
Since blood flows to the penis at a much greater rate when you have an erection, the best way
to keep the muscle tissue in your penis properly oxygenated is by having more erections. There,
now you have a legitimate excuse to masturbate.
ANCIENT SECRET:
"Place your thumb on the top of the penis at the root and your index finger at the bottom of the
penis at the root. Take a deep breath and while holding, squeeze and grip the shaft of your penis
in a wave toward the tip of the penis. The thumb, the index finger and the pinky finger push,
forcing blood into the penis head. Now hold this grip for as long as you're able to hold your breath.
Repeat this exercise 9 times. Each time you hold your breath, count to 9 and with each count,
squeeze more toward the head of the penis."
Ejaculation Control
First of all, it should be noted that one man in 3 ejaculates quicker than he wants to, and that
the vast majority of men sometimes ejaculate too quickly. So if this happens to you, you're
hardly alone.
The following are some tips and exercises that will assist you in learning to control this
problem:
You can learn to tolerate long periods of sexual pleasure without ejaculating once you
learn to recognize the feelings that precede your orgasm. There is an exercise you can try
called The "One to Ten" Approach. Imagine that the scale of pleasure runs from 1 to 10: 1
you are just starting to feel aroused; 10 you have an orgasm and ejaculate. Therefore 9,
the point just before your orgasm, is your point of no return. Try masturbating. When you
reach your magic point 8, stop and let the urge to ejaculate subside. Then start
masturbating again. Do this a few times. Masturbate, stop, masturbate. At the end of 15
minutes you can ejaculate (if you wish). Repeat this technique until you are able to enjoy
your arousal without ejaculating for 15 minutes.
Another method that reduces the chance of premature ejaculation is one that we mention in
your workout- Give Your PC Muscles a Squeeze. Review our discussion of Kegel (PC) Muscles if
you've forgotten where these muscles are located. Strong PC muscles operate like a good set of
brakes in your car- by contracting the muscles, you can control your arousal the same way you
use your brakes to control speed. In the broadest terms of how to apply this muscle when
making love, you prolong orgasms by a simulation of "stopping your urination in midstream".
Learn the powers of these muscles and how to use them. They will work wonders in the
bedroom!
Finally, the oldest, simplest & best method for learning ejaculatory control is called the Locking
Method. When having sex, if you feel yourself becoming too excited... simply withdraw your
penis from the vagina and pull back so that only the head of your penis remains inside her.
Then just remain motionless for 15 - 30 seconds. Wait for the urge to subside, then back to
where you left off.
FAQ
Below are a few of the most frequently asked questions about our manual:
When should I use these techniques?
Whenever you wish. A lot of men do their workout first thing in the morning, and others do it
before they go to bed at night. The actual time of day will not affect the process.
Can I ejaculate right before, during, or after exercising?
When you ejaculate your body goes through several chemical and physical changes, first your
blood testosterone levels begin to drop, second, all your connective tissues begin to tighten as
well, it is best to wait at least several hours after completion of the exercises before ejaculating,
just as it is also important not to ejaculate for at least several hours before exercising as well.
When I jelq I get a little, (or a lot) sore, is this normal?
Check the soreness and see what is causing it, you may just need to trim the pubic hair right at
the base of your penis. Is it a sharp pain or just a dull discomfort? Are you doing the hot
wraps?
A slight discomfort/soreness is normal and should pass as your penis and all supportive
structures get used to the exercises. Try not to stop, a slight discomfort is normal, if the pain is
sharp or is strong enough to keep you from exercising take a few days off from the exercises
while continuing to do the hot wraps.
How can I keep from getting erect when jelqing or stretching?
DO NOT JELQ WHEN FULLY ERECT FOR ANY REASON!!!
When you are just starting out on the program your penis is accustomed to getting hard from
the stimulation because it is always being used for the same thing, get hard, get stimulated,
achieve orgasm and ejaculation. After a couple weeks to a few months your penis will be
accustomed to the exercises and the erections should be more controllable. During these first
few weeks if you get an erection take a few seconds or minutes to let it subside, you won't hurt
anything as all these first few weeks are for is so that Mr. Penis, (and you), can get accustomed
to the exercises.
Can I do the exercises twice a day?
The ideal heal time for tissues in your body is 48 hours, (depending on the tissue type, muscle
tissue is one of the the fastest, nerve tissue is the slowest at 1 to 2 mm a month). When you
exercise more than once a day you are not giving Mr. Penis time to heal correctly often times at
the sacrifice of growth.
I'm not circumcised, is there anything special I should do to do the exercises?
Not necessarily, there are mainly just two things you should be aware of. First, when jelqing be
sure to stop just at the base of the head, second, if you choose you can use your free hand to
retract the foreskin then jelq as you normally would.
How do I find my pc muscle?
An easy to find your pc muscle is: When urinating, stop the flow of urine without using your
hands, and no, it's not your anal sphincter or your abdominal muscles. After time you will get
good at it and will be able to do it whenever you want, this is flexing your pc muscle. For
starters stop the flow of urine as many times as you can every time you go. After a few days you
will be able to do it whenever you want. Try and do as many Kegels as you can every day.
Kegels are the exercise that work the pubococcygeal (pc) muscle.
Do I have to do the Hot Wraps?
The hot wrap should not be considered optional as they serve two main purposes.
•
First they serve to loosen connective tissues so they can stretch more easily with less
risk of injury.
•
Second the hot wraps serve to increase penile circulation which in turn increases the
amount of nutrients that reach your penis.
When can I expect to see my first gains?
Most begin to see their first gains at around the second week with others seeing gains after
their 2nd month, some see gains as soon as the first exercise session. You can expect to see
flaccid gains before erect gains as your penis becomes more accustomed to the increased blood
flow.
I don't have enough time to do all the exercises at once, Can I spread them out over the
day?
Yes. We know that sometimes it is hard to find the time. If you wish to split the exercises up
during the day, then do so.
Why can't I do the exercises 7 days a week ?
You must rest your penis for two days, This is essential for healing. YOU MUST ALLOW TIME
TO HEAL. Many men spend a year or more trying to achieve enlargement, but never seem to
grow. This is because the cells and tissues in your penis, after being stretched in exercise, must
have enough adequate time to rejuvenate and build back up. This can only be accomplished
through the rest time that you take off each week.
How long can I keep using these techniques?
You can use the program forever if you like. But practically speaking, your penis can only be
increased SO much. You will see the most substantial growth within your first 6 months of the
program (although some men may need a few months longer). However, after that time your
penis may only grow a half inch a year, but there will be a slight size gain.
Ultimate Guide To Penis Enlargement Techniques
By: ACME
Table of Contents
1.Hot Compress (5 minutes)or shower
2.Stretching Exercise (25-30 minutes)
3.Growth and Circulation Exercises (1 minute)
4.Jelqing Exercise (10 to 20 minutes)
5.PC (Kegel) Exercises (5 minutes)
6.Delay and Harden Technique(10 minutes)
7.Glute Flexes(10 minutes)
8.Massage and Hot Application (5 to 10 minutes)
9. Porn star Routine before sex
*Hot Compress (5 minutes)
Soak a wash cloth in hot-warm water, wringing out the excess
water. Wrap the cloth around the shaft of your penis(either
flacid or erect). Hold it there a minute, then repeat a couple of
times. Dry off your penis well. This will ensure a good grip for
the exercises you're about to perform.
Stretching Exercise (25-30 minutes)
1. With the penis in its flacid state, take one hand and grip
firmly around the head of your penis. Be careful not to cut off
too much circulation.
2.Pull your penis out directly in front of yourself.
a.Stretch it as much as you can without causing pain or
discomfort.
b.Hold it there for 5 minutes.
c.After each minute, pull it out slightly further each time.
3.Relax for one minute.Twirl your penis in a circular motion
about 30 times. This gets the circulation flowing again.
4.Repeat Step Two again 4 times, except pull your penis in a
different direction each time... up, down, to the left, and to
the right . After each 5 minute pull, repeat Step 3.
5.After you've completed 5 pulls (5 minutes each), pull your
penis out directly in front of you one more time. Give it a
good 1-minute stretch and 10 slight tugs outward, not
jerking too hard.
Growth And Circulation Exercise (1 minute)
Take the penis and whip it around gently. Whip it no more
than 30 times, making sure you cup your scrotom with the
other hand, otherwise it will bounce around and get hurt
Jelqing (Milking) Exercise (10 to 20 minutes)
1.Using Massage Oil, Hemp Oil, or Vaseline for lubrication,
slide your fingers over the skin of your penis and apply all
over. A few drops of oil will last for several hundred strokes.
Don't use soap or you'll be sore for days!
2.With your thumb and forefinger, squeeze the base of the
penis shaft. Pull downward. Stop at the head. Repeat,
alternating hands. Make each stroke last about three
seconds. This sensation should last about three seconds. This
sensation should help you achieve an erection.
3.When your penis becomes SEMI-ERECT, make the American
A-OK sign with the thumb and forefinger of you're left hand.
With this hand, grip slightly around the base of your penis.
4.Now starting from the base, pull the penis gently but
firmly. Stretch downward and outward. You should still be in
a semi-erect state. Make sure to touch the penis from the
base to the head. Note that the head of your penis expands
with the blood.
5.Switch to the right hand and do the same thing, starting
from the base and stretching downward to the head.
Alternate both hands in a smooth rythmic (milking) motion,
touching upon every part of the penis except the very top of
the penis head.
Do 200-300 strokes/ day at medium strength for the first
week.(10 minutes) Do 300-500 strokes/day/at medium-full
strength for the next week. (15 minutes) Do 500 or more
stokes/day from then on, and strong as you can make them.
(20 minutes)
If you find yourself getting an erection during this exercise,
squeeze harder to discourage it or simply wait until it
subsides. You can encourage circulation afterward by
slapping your penis only partially erect.
PC (KEGEL) Exercise (5 minutes)
PC (KEGEL) Exercise (5 minutes)
Butt Crunch Do different variations of theses exercises each
time you perform your workout. You can also do PC exercises
throughout the day while you're driving, watching t.v.
whatever.
1.Perform quick PC CLAMPS. Squeeze and release, over and
over. Start with a set of twenty, then build to a hundred or
more. Do at least 250 PC clamps every day, for the rest of
your life. Your goal is to be capable of creating 1,000 clamps
a day.
deep, slow breathing while you do this. This is great for
restoring energy when you're running down!
5.When you Urinate and you want to let those squirts shoot
out, you use your PC muscle in the other direction. By doing
this you'll feel your anus open and the sensation is different.
This is calles the Push Out PC.
Delay and Harden Technique
Take a little baby oil and massage into your penis. Once you
have massaged
yourself to a hard erection, take your hand and grip around
your penis at the very base, against your pelvis. Now with a
very sturdy grip, squeeze as hard as you can, and hold for a
30 count. The part of your penis showing should be very
hard, and quite red from the pressure being drawn onto it
from the force of your grip. After you hold for 30 seconds,
masturbate until you feel utmost urge to ejaculate, but don't.
Once you feel an overwelming urge to cum, stop and do the
squeezing technique once again, except hold for 45 seconds,
then do it again for a full minute. Keep repeating these steps
adding 15 seconds each time you grip. Work your way to 2
minutes. After about a month you should be able to work up
to 10 minutes.
Glute Flexes
Lie on your back, and make sure you are on a floor, or firm
surface so that you have the appropriate resistance to force
against(i.e., the carpet, floor, ect. Your bed is far to giving
and will not work for this exercise.)
1. Flex your buttocks as hard as you can, holding for a slow 3
count, then unflexing. Do these 5 times to warm up.
2. Flex and unflex in a fast, steady pace for 3 sets of 50, or if
you can't even do 50, do as many as possible. Rest for 30
seconds between each set, and take in deep, slow breaths
through your nose, and exhaling through your mouth.
3. Next, flex as hard as possible and hold for as long as you
can until you start to tremble. Once trembling, unflex and
repeat 5 times.
4. Repeat step 2
5. Repeat step 3
6.Finish by doing very rapid flexes continuously for as long as
you can before you totally fatigue.
Massage and Heat Application
After your workout, gently massage your penis for several
minutes. If you prefer, you can do this with an herbal
enlargement cream. After massage, you can either apply
another hot compress as you did at the beginning of your
workout, or you can place your penis in a bowl of lukewarm
water for another few minutes. Dry off with a towel.
Porn star routine before sex
1.Strengthen your PC muscle for several months doing at
least 500PC flex's a day
2.Eat plenty of fruit, vegetables, and drink 200 ounces of
water a day.
3.Get plenty of sleep each night
4.Withstrain from ejaculation for a few days
5.Take L-Arginine as directed above the night before, and day
of sex.
7KLV&RXUVHZDVZULWWHQIRUWKHFRPPRQPDQ
LQSODLQ(QJOLVKDQGLQ1DUUDWLYHIRUPE\VHYHUDO
GLIIHUHQWDXWKRUV
(DFKDXWKRUGHVFULEHVKLVRUKHURZQMRXUQH\LQKLV
RUKHURZQZRUGV
1RDWWHPSWKDVEHHQPDGHWRHGLWRUGLOXWHWKHLU
ZRUGV7KHUHIRUZHDSRORJL]HLQDGYDQFHIRUDQ\
(QJOLVK/DQJXDJH5XOHVWKDWDUHQRWDGKHUHGWR
DVWKHVHPHQDQGZRPHQDUHVLPSO\WUDYHOHUV
$QRWKHU1RWHRIVLJQLILFDQFHLVWKDWWKHPRVWHIIHFWLYHWHFKQLTXHV
DQGVHFUHWVPRVWRIWHQFRPHLQWKH
VLPSOHVWRISDFNDJHV
7KHUH¶VQR0DJLFKHUHRQO\WUXHQRQRQVHQVHPHWKRGV
ZKLFKGRZRUN
³2SHQPLQGVDQG2SHQ(\HVDUHWKHZRUGVDQGDFWLRQVRI
WKH:LVH´
$IULFDQ3URYHUE
2ULJLQDOO\IRUPDWWHGIRUWKH:RUOG
VPRVWSRSXODUZRUGSURFHVVRUV
:RUG3HUIHFWDQG:RUGIRU:LQGRZV
:HDSRORJL]HIRUWKHSDJHGLIIHUHQFHV\RXPD\H[SHULHQFH
7+,60$18$/,6'(6,*1('$1'/$,'287)25
($6<5($',1*:+,/(<2835$&7,&(
7+,6,1)250$7,21,6&21&,6($1'727+(32,17$6
6+28/'%()25$1('8&$7,21$/&2856(
+RZHYHUZHHQGHDYRUHGWRUHWDLQDVPXFKRIWKHHQWHUWDLQPHQWRIWKH
RULJLQDOPDQXVFULSWDVZHFRXOG
:HDOVRGHFLGHGWKDWZHFRXOGQRWWKRXJKZHWULHGLQVHUWHYHU\WLS
DQGWHFKQLTXHWKDW
VFRQWDLQHGLQWKHRULJLQDOZLWKRXWRYHUFRPSOLFDWLQJ
WKHHGXFDWLRQDOOLQHVWRWKHYHU\LPSRUWDQW
7KUHHSRLQWVRISRZHU
7KHUHIRUZHKDGWREUHDNWKHFRXUVHGRZQLQWRWKLVEDVLF
WKURXJKDGYDQFHGDQGWRIROORZVRRQWKH$OWHUQDWLYHV
6XSUD$GYDQFHG
7KLVODVWO\PHQWLRQHGFRXUVHZLOODOVRRIIHUDGGLWLRQDOWHFKQLTXHV
WKDWDUHDWWKLVWLPHEHLQJJDWKHUHGIURPWKHJDUGHQVRIWKHZRUOG
$VDOZD\VDJHQHURXVGLVFRXQWZLOOEHRIIHUHGWRDOOZKRSXUFKDVHG
WKHILUVWFRXUVHLQDGGLWLRQWRPHPEHUVKLSLQWKH=HQQR-RMLGR6RFLHW\
ZKLFKZLOOHQDEOH\RXWRDWWHQGWKHOLYHZRUNVKRSVDWYDULRXVUHVRUWV
DURXQGWKH*OREH
%HIRUH\RXEHJLQWKLVRUDQ\H[HUFLVHSURJUDP
SOHDVHFRQVXOW\RXU3K\VLFLDQ
,I\RXIHHODQ\SDLQRUVWUDLQVWRSLPPHGLDWHO\DQG
FRQVXOW\RXU'RFWRU
8VHWKLVPDQXDOUHVSRQVLEO\VHQVLEO\DOZD\V
SUDFWLFHVDIHVH[
3OHDVHNHHSWKLVRXWRIWKHKDQGVRIPLQRUV
:HWDNHQRUHVSRQVLELOLW\IRULQMXULHVWRDSHUVRQRUSHUVRQVUHVXOWLQJ
LQWKHPLVXVHRUDEXVHRIWKHFRQWHQWVRIWKLVFRXUVH
• 123257,21253257,2162)7+,60$18$/&$1%(
• 5(352'8&(':,7+2877+(:5,77(13(50,66,212)
• :25/':,6($//9,2/$7,216:,//%(3526(&87('
&23<5,*+7‹:RUOG:LVH
$//5,*+765(6(59('
:*$
MEN,..... FINALLY.... THE SECRETS HAVE BEEN
REVEALED.. ZENNO JOJIDO
The Sexual martial art & sexercise.
Once only known to a select few around the world,...
the power is now in your hands !!
The secrets to build it to its natural maximum size,
keep it up, & regain or retain that teen's ability to
keep it coming !!
Also, find out the winning card that the Afro-American
male holds in the arena Sexual prowess !!
Contents :
SECTION 1. Page 7
The Factors regarding Size & the Females need.
SECTION 2. Page 14
External development;
(maximizing Size, Strength, Conditioning, muscularity and
flexibility) (Sexercise).
SECTION 3. Page 31
Internal development & Climax control !
Or (tricks of the long distance runner)
SECTION 4. Page 38
Multi-gasm & the one hour joyride.
SECTION 5. Page 45
Master Strokes ! Or ( moves to do the job)
Putting it all together.
ZENNO JOJIDO
Closely guarded secrets gleaned from around the world From
Asia to Africa have been combined to form the most powerful
method of making love, ever, to be in the hands of any one person.
Available in both Male & Female versions.
You can now earn your Black belt, in the most satisfying
martial art of all.
Brought to you by,...........
Hello people,........we are World Wise and our mission is to
make the main connection of life, that magical hook-up
that makes two people one, & creates life,.. the most
wonderful & satisfying experience of Life.
To this end, we have traveled to 19 countries
around the world, researched the various sexual histories,
attitudes, & secrets.
We have interviewed hundreds of people, attended live
sex demonstrations, & experimented personally & the result
is this entertaining, informative & factual manual
that will astoundingly improve your love life & self image.
We implore you to take full advantage of every secret we reveal
to you, as we have researched them ,
to the maximum, use them ourselves
& know them all to be actual & factual.
Section 1.
Size and Female Requirements
" BIG PENIS EQUALS WOMEN'S NEEDS SATISFIED' ? "
In this culture, the damage of this myth is driving men who
don't measure up into purchases of gadgets of all kinds,
pumps, extenders, & even sports cars.
More dangerously some men are opting for radical
& expensive forms of surgery.
All of these men are wasting their precious time & money.
Though penis size is not as important as the myth claims,
size can be added naturally by building the muscle like
organ called the "Penis."
Building the penis instead of artificially enlarging it, brings the
added & most important benefits, of conditioning & strength, and
flexibility, which will bring you more praise in
your performance than any
Jumbo size one minute lover.
All myths aside, what do women actually physically need in
inches to get off ?
What do they require for fulfillment ?
Well, let us start with a little anatomy,.... 1st of all, a woman's
vagina only has nerve endings in the 1st 2 inches from the
opening,.. most of those being right around the ring of muscle,
or mouth of the opening.
Therefor, if a man with only a two-inch penis who knows all
the factors (you will know the factors),…
is with a woman who has learned to bring about a vaginal climax,
he will bring her to orgasm !
If she is among the women, who have yet to learn
how to experience a vaginal climax, don't despair,
for you will learn a methods which will carry her into
climax as well !
'' What about penis thickness ? " Do you ask?
Well thickness can be important,..
However, the need & degree of thickness,
depends upon the amount of muscle control a woman has.
It is Not, as one has been led to believe, Age, or the
amount of babies, or partners a particular woman has
gone through, which affects that need.
In Japan & most Asian countries, size is not a factor simply
because Vaginal muscle control has been raised to an art form.
Cont,..
WE have witnessed live sex shows in the red light districts of
Singapore & the Philippines.
There women push six ping pong-balls into their vaginas,
then shoot the balls out, one at a time, 15 feet away,
into a bucket, using only their vaginal muscles.
The popping sound that those powerful vaginas make, as
the balls are released, is astounding !
More striking, is the " His lover's Banana Cutter " where a
peeled banana, is fully inserted into her vagina,
and as a man lays under her vagina, mouth open wide,
the fruit is pushed out & sliced bit by bit by the muscles
of that magnificent vagina !!
Then there's the "Payday" where women stack 5 inches of
coins on the lip of a coke bottle, squat down, engulf the coins with
their sex organs, then release them by any number you request into
your hand.
As you can imagine, these women know how to please their
lovers & themselves, no matter the size of the penis.
We know for a fact that as lovers, these women are fantastic!
For even without any effort or technique from our members,
the women kept them up- and going all night.
Unbelievably in the sunshine of morning,
the men were still up for more !
Unfortunately, in western culture, these skills are not
known or practiced,
yet,...
(but not to worry brothers... we're working on this problem too.)
........therefor the only known equalizer to a weak,
& untrained vagina is "Size" !!
Notice we said "known" equalizer,...because there are methods
and means you can utilize which will please a woman,
yourself included within this culture,
that do not require excessive thickness or hose length.
When you maximize your penis size, add correct motion,
conditioning, & control,
{all of which you will have mastery of},
then you will be able to please any straight woman,
loose or tight, muscle tone or the lack thereof.
You will be experiencing delicious Sex and Explosive climaxes
beyond your wildest dreams as well.
Next, learn what the optimum size is,…
Size,...the pitfall's & advantages
Since most of us know all to well, the perceived pitfalls
of having a smaller than an average penis,
whether we have one or not,..
Let us start with the pitfalls of having a
larger than an average penis.
After interviewing hundreds of women & men on this subject..
More than three quarters of the women complained,
that a large penis used incorrectly was a huge barrier
to enjoying sex and makes the act a
dreaded & uncomfortable undertaking.
The same percentage of larger than average men,
have experienced grief and weathered the complaints
and excuses of causing their sex partners pain and suffering.
This situation can seriously affect a couple’s sexual
relationship, make oral sex a rare and brief event and
anal sex a near impossibility.
Complaints of excessive thickness above one & one\half inch's
diameter of thickness, (average size)
if the female is built small, does not lubricate properly,
or has not born a child,
sex can be a major undertaking requiring her to bear the pressure
& pain of the vaginal walls actually being torn apart!
Then there's the length factor, where if the length was
above 6 inches (average length)
for some women, an uncomfortable feeling
of the penis reaching up into the internal reproductive
organs & pummeling them was prevalent.
These situations can & do cause serious damage like cysts that
require surgery, & infections that could result in the loss
of childbearing capability.
However, these situations can be greatly reduced
with knowledge of how to use your tool correctly.
We will cover how later.
Advantages of the larger than average penis are
as we all know too well are;
If the woman has a loose,
out of shape vagina and little control, a large tool
can give her the feeling she once had when she was
young & inexperienced, whether the man knows the
correct methods and techniques or not.
Conversely,.. smaller than average penises can be of advantage to
women with small & tight vagina's.
Like the large male & loose females match,
these combinations can make it easier, and
allow one to complete the act in a satisfactory fashion,
but the fact remains that in order to maximize
the Erotic experience, Prolong it, as well as
carry your partner with you, up into the light of Ecstasy,
special technique's & conditioning must be learned,
practiced, and implemented.
Techniques available here.
Next we discover the Samurai Building techniques,..
Section 2 Building that structure.
Penis building, Samurai Style...
I'm in Japan, home again, for the first time in
more than 17 years.
It's raining outside of the cab I've hired to take me
through the hills of a city called Hyama.
I'm to visit a person whom I understand is the master of an
ancient form of martial art, not known to the West, or even to most
of the East.
As we pass people scurrying with their umbrellas,
and turn the corner where a shrine shines with the rain,
I wonder what I might find.
The rain clears as we pull in front of an older looking home.
The door is answered by a kindly bent old woman, who bows after
I introduce myself & then she smiles while I sit on a bench in the
foyer to remove my shoes & put on the offered slippers.
She leads me to a sliding rice paper door, which she opens
& I am greeted by an old man, who stood up from
a cross legged position with the grace of a cat.
I was taken aback by his remarkably strong & alert gaze.
I bow respectfully after which he bade me sit at a low table.
After over 30 minutes of tea & pleasantries,
a must in Japanese society,
I can no longer hold my curiosity and I inquire after for
which I have traveled so far.
At once, I felt I knew had made a huge mistake.
My memory flashed the once forgotten knowledge
of Japanese rule of the indirect.
I had been away for far too long , for the Japanese
would never be so impatient and direct.
It is considered rude.
He sat there motionlessly without speaking for what seemed
like five minutes, reading my face before he kind of sighed
in a disappointed manner, and finally spoke
"This is a secret used for centuries by the Samurai, who believed
in exercising all muscles of the human body.
From under a floorboard, he produced a black lacquered box, and
with a sparkle in his eyes, he said " This is the secret to youth !
I can now at age 82 outlast you."
With this, he proceeded to open the box which took a few
minutes because it was a puzzle box that required a combination of
sliding panels to be moved in a certain order.
Finally,..
the box opened to reveal four disc shaped stones of various sizes,
with holes in the middle.
To tell you the truth, I was confused &
not just a little disappointed.
But after he explained, I understood completely.
The stones were weights that were pushed over the head
of the penis when it was flaccid, then as it swelled,
the stone would stay in place & then be lifted by the muscles
of the penis in reps,
thus building & strengthening the middle erector muscle,
the tube that runs along the bottom & center of the three tube
muscles of the penis.
As I examined the stones, I noticed the intricate erotic artwork
carved on them, but more important, the weight of even the
smallest stone was to me quite heavy.
The stones according to him, were made in the 18th century
and were unavailable today, unless I could convince someone
to sell me theirs.
However, try though I may, I was unable to even locate
any of the stones, let alone purchase any.
This led us to create a more modern & efficient version of doing
the exercises & even creating a device that is three times as
efficient as the original,
but more on this later.
These exercises were then combined with
Secret exercise techniques called “Cow Milk” which
would complete the building process.
Not to be confused with masturbation, these
advanced methods are the most effective form
of manual manipulation for strength and size
available in the world.
Note: We use the term “Muscle”
with regards to the penis.
Some refute this as incorrect, however we
know from many decades of experience,
that certain tissues of the penis behaves,
and reacts to exercise, in the same manner as muscle,
so for lack of a better word, we will throw semantics
aside.
We begin the building techniques on the next page,..
DAY 1
Basic beginner method for building the
middle erector muscle.
This first exercise is very basic, and in our
opinion builds only the lifting or Angle of Erection
muscles of the penis.
If your erection is high, (lifts almost to the stomach)
and you feel that you have no need for the basics,
we would suggest that you still begin here,
just to build a solid base
for the more advanced techniques to follow,
as well as to prevent future problems in this area.
To start, no device is needed.
The material you will need is a wash cloth, a bowl of water, & a
lubricant. We would suggest some long lasting lubricant made for
sexual purposes like K.Y. jelly (purchased at any large grocer) or if
you are used to a certain oil or lotion,
then by all means use it.
First, find yourself a private room, where you won't be
disturbed for at least thirty minutes.
Now remove your clothes, & sit comfortably, knees apart,
on the edge of a chair, or the edge of the bed with
your feet planted firmly on the floor,
so that your penis & testicles are hanging off, or stand if you wish.
Now you must achieve an erection.
If by chance you have difficulty in doing so, try to focus on a past
situation, or fantasy that turns you on.
Use any method you are currently used to achieve erection,
including magazines or videos.
If you are unable, we are working on methods
to help you get there and remain.
Write us.
Once you are erect, take hold of the penis with one hand, palm
facing down, with the head, nestled in the middle of your palm.
Now push the penis as far down as you comfortably can
& pause while you gather your thoughts
think of the muscles in the penis, all along the shaft down to
the parts that run all through to the anus, ... additionally,...
squeeze gently the internal muscles that cut off the flow of urine,
called the Pubococcygeus. (Correct Spelling)
Since this is too difficult to pronounce, we call it the P.C. muscle.
This last muscle is one of the most important muscles in your
body for sexual purposes & will eventually when well developed,
allow you to control ejaculation, to the point of maintaining that
fantastic pre-orgasm state for as long as you wish.
Okay now, still holding the penis, take a deep breath and hold
it briefly for one second and exhale slowly through the mouth,
making a Haaaa whisper sound as you pull
in on the stomach muscles.
Repeat this twice, and on the third one, resisting the effort
slightly with the hand, attempt to lift the penis to the navel using
only the muscles of the penis, the anus and especially the P.C.
muscle, additionally, time your exhalation so it lasts the full effort.
Do this three times,.. then remove you're hand from the penis &
drape the washcloth over the penis.
If the washcloth is not heavy enough, & does not weigh the penis
down, then wet the cloth in the bowl or water,
wring it if necessary & re-drape it.
Take a deep breath as before, hold it one second, then as you
exhale with the Haaaa sound, do two slow lifts of the towel with
each lift lasting 5 seconds, so you are exhaling
for 10 to 12 seconds.
EXCELLENT !!
Now,... Take a two minute or so break & repeat the exercise
for three more exhalations.
Now you should masturbate to full orgasm, but try to make it
last for as long as you can before you allow ejaculation,
because your ultimate
goal will be to last more than thirty minutes,
so if you can, shoot for it now, but if you cannot,
don't despair because you will reach that goal & beyond
sooner than you think.
Techniques to perfect delaying ejaculation will follow.
This is all for the first day.
However don't forget to exercise your P.C. muscles, use them to
cut off the flow of urine, after which
alternating to force the flow outward more forcefully.
Do this several times during each and every urination.
DAY 2
Go back to your private space & allow for the same time for
today's exercises repeat the steps;
1. Use any method to achieve erection.
2) Hold the penis with the palm facing down, &
the head nestled in the middle of the palm.
3. Practice the P.C. squeeze, the penis muscles & anus
squeeze a few times.
4) Take a deep breath, hold for one second then pull
the stomach muscles
in while you breathe slowly out through the mouth making the
Haaaa whisper sound to a count of 10 seconds.
5. Now drape the towel over the penis & perform the lifting
exercises as you did on day one. The difference today is you will
try & increase your sets to six exhalations or 12 five-second lifts.
EXCELLENT,.. Now when you have completed this section,
you can move on to the enlarging techniques,
starting on the following page.
The All Important "Cow Milk" Method.
This next series of exercises will build a thickness
to your organ.
Keep in mind that the changes do not happen overnight,
and in some cases months may pass, however do
not give up!
We cannot stress this enough, as different body types
respond in different rates.
One key to remember is that the longer it takes you
to respond, the more dramatic and prolonged the
improvements over time to where some men
continue to achieve gains for years afterwards.
Begin Thus,
(Note: For some, better results can be seen if one
takes a hot bath before, or during these exercises)
Lubricate the penis with whatever lubricant you have on hand.
(If in water, use soap)
Rest for five minutes while maintaining erection
by stroking slowly while relaxing.
Then start squeezing quite strongly, the whole penis from base to
tip, like farmers do, when milking a cow, also pull the head down
toward the knees, as far down as you can.
Use your fingers, especially the tips to rub
deeply into your shaft.
(If you feel any pain, Lesson the pressure.)
Then push the penis through your hand with the same pressure.
Do this with the right hand then the left hand, so that the fingers
can massage both sides evenly.
Spend at least ten minutes with each hand,
more if you can.
Then reverse your palm,
so it is holding the upper side of the penis,
and the fingers are wrapped tightly around the underside,..
Then pull the hand down as close to the base of the penis as you
can,...at the same time,... push the penis down, in small bounces,
to stretch the ligaments that hold the penis to the pubic bone.
Hold the position applying pressure and bouncing gently but
firmly for a few minutes.
(This is best done in hot water which will help relax
the ligaments.)
End the stretch with a milk squeeze out toward the head of the
penis, and use the fingers to firmly massage the underside of the
side tube from the altered position,
Repeat this last step about twenty times
with each hand.
Okay now,
Making sure your lubrication remains in full effect,
Twist your wrist so the extended thumb can rub the
underside of the Right or left tube,
(depending on which hand you are using)
and Pull outward, applying pressure along
the whole length of the penis, squeezing with
the whole hand,
but putting an emphasis on the thumb.
Now switch hands and repeat.
Be sure to always end your pulls with a strong push of
your penis back through a strong hand.
Repeat all these exercises until you feel a
good swelling.
The Cow Milk, or Super-Jelq series of exercises
are very important ,
for not only will it increase blood flow to the penis & eventually
size, & length,.. it will build a firm turgid toughness into your
erection that's excellent for the thrusting techniques
you will soon learn.
So even though this if new to you, will take some getting used to
as a form of masturbation, we implore you to do it until you are
comfortable with it & we guarantee you won't be disappointed !!
Now masturbate to orgasm, however use the cow milk techniques.
Though we know some of you are tired, numb, or both,..
try to last a full thirty minutes by doing moderate stimulation, only
enough to remain erect, but not enough to boil over.
The attempt is very important.
Then this time at the point of orgasm squeeze your P.C. muscle &
attempt to keep your ejaculate inside, you will not be able to at this
point, but eventually you will, & one quick bonus is the effort will
allow you to become sexually active a lot quicker than usual
starting today!!
Try later to get sexually aroused and see for yourself.
" IMPORTANT,!!!! "
Do not use your hand to attempt to squeeze the sperm inside
because this can cause serious damage to your
ejaculatory muscles !
Very important, for those seeking additional gains.
After your climax, and your erection has
softened but not deflated, do, for as long as you can,
additional cow milking, in all the various forms.
This will aid as well, in your size growth, and eventually,
will allow you to continue intercourse even after a
zero control climax.
However the point right now, is to take advantage of
the semi-erect state, for stimulation of tissues which cannot
be reached when fully erect.
This is all for the day, skip a day or two between you're next
session to allow the muscles to rebuild & remember use your P.C.
muscles when urinating, both the stop flow & the force flow.
Day 3
This third day should follow a day or two of rest from
day 2 session.
This day we are going to practice on controlling the movement
up and down the effort on order to gain from
the negative resistance.
Go through steps 1 through 4 as before,
but on step 5 there's a difference.
5. This time, there being a difference in the lift.
Instead of doing two lifts on one exhalation,
we need you to lift as before to the count of five but this time,
control the drop of the weight to a count of five also.
So it goes as so, lift 1 2 3 4 5, then descent control 1 2 3 4 5 .
This will give you double benefit & muscle conditioning.
Repeat this a total of 12 times then cow milk for
at least 6 minutes.
Now cow milk to orgasm once again & keep the 30 minutes in
mind. Don't forget to squeeze as much of your ejaculate in as
possible with the P.C. muscles only.
This is all for the day.
Please don't forget the P.C. squeeze & force flow when urinating.
Day 4 & beyond,
Pop open the bubbly, for Congratulations are in order !!
Now you have learned the basic method for building
& conditioning the external muscles on the middle tube
which runs under the penis, & you have begun to gain
mastery of the wondrous P.C. muscle !!
All that remains is that you increase the resistance with more
weight by using larger towels & more water
& also the sets or exhalations
as you gain in strength.
Do the exercises at least 2 times a week.
You will begin to see immediate & dramatic results not only in the
strength & power of your erection, but also you will be more
virile,
& able to regain desire & erection a lot quicker after orgasm.
If you desire more masturbation or sexual activity,
don't forget the cow milk technique.
If you are with a partner, try to last the 30 minutes
and attempt the
P.C. squeeze on ejaculation.
NOTE; ...there are two more muscle tubes on the penis
that run along the left & right on top of the middle tube
that can be built & conditioned in a different manner.
There is a specialized
device made for the purpose of advanced building
all three tubes on the penis.
If you are interested in maximizing your size & power,
we will extend to you an offer of a generous discount in the
purchase of this fantastic device !
Read all about it at the end of this book.
Internal muscle control has just been touched on & we will
cover it in detail in the next chapter.
SECTION 3.
Tricks of the long distance runner.
The BANGKOK BANGCOCK
Another turning point in this course started
in Bangkok Thailand, where I was sent to witness
what I thought at the time
was a freak of nature.
In a secret theater on a back street,...
a group of Pacific islanders
gave an amazing performance.
Five young women & One man of about 45 years of age,
put on a live sex show that was an unforgettably dramatic
and moving drama, of lust & desire !!
The simple stage was set up like a jungle, complete with a
small hut, from which the women emerged,
then started to fight one another to mate with this man,
who stood passive, arms folded,
with bright face paint,
& native grass adornments.
What caught the eye was a huge bamboo penis holder,
which stood upright in front of him.
The wildest of the women was the first to reach him & remove
the bamboo "jock strap" and a gasp went through the crowd of
about 27 people,.. women & men all tourists.
His penis was about as large as the bamboo & very erect !!
Wild woman immediately grabbed hold of his broad shoulders
and jumped up, to engulf the huge penis with her soaking vagina
down to the root !!
Mr. Amazing took them all in turn, while the other women,
like starving nymphs, scrambled to touch, hold
& suck any exposed part of his penis.
This man satisfied them all, with amazing agility,
exotic positions, & ravenous hunger, but more amazingly he
ejaculated for each and every one of them,
over a two & one half hour period,
in which his erection grew larger
& more rigid as the minutes passed.
Needless to say, I had to know his secret.
A secret he refused to reveal, even after days of coaxing,
drinking, even offers of payment.
Finally after 5 days, when I was about to give up
& return home,
he confessed that he held his secret tight because
he feared that his livelihood would be threatened if I,
or anyone went into competition with him.
Well after solid assurances that his means of
making a living would be safe, as we could arrange
payment enough for him to make a down payment
on his own drinking establishment,.. he agreed to reveal to me
this secret that was taught to him by his sexual mentor, an
older Chinese woman who called it an
"Ancient art from the Golden era "!!
We of course will share it with you now !
Internal control
Remember that teen sex ?
Those hot, steamy sessions when you could climax,
retain erection, desire then climax again and again ?
That ability was due to the young tone of your internal muscles,
and an instinctual urge to hold in your ejaculate.
Over the passing years, you slowly lost that ability because
the muscles once used, but not exercised,
were stretched out of shape.
This chapter will teach you how to awaken those muscles
and put them back in tone so, you once again
can perform as you were meant to.
You are three small internal exercises from a paradise of
sensations, additionally you will gain control
that will bring you more well-being & confidence
than you could ever imagine !!
No worries about having enough time or privacy to accomplish
these simple exercises, for they can be done while driving,
as well as while reading, watching movies ect. ect..
The three exercises are as follows;
1. Pulsating P.C. squeezes, two sessions a day.
Do ten squeezes per set, and five sets per session.
To start, do as many as you can easily do.
Goal 100 per day or more.
2) Pulsating P.C. pushouts.
These exercises are similar to what you are familiar with already,
but the difference is they are pushouts instead of squeezes.
When you attempt to push out the last few drops of urine,
you are using the P.C. pushout muscles.
As you bear down to use these muscles, the anus will also open.
Do this a few times to get used to the feeling.
If you have problems feeling these muscles move,
wait until you urinate then use the muscles to force
the flow out more forcefully, then you will be able
to recognize the feeling next time.
Do these next exercises in the same setup, as the
above squeezing exercises.
Build up on these exercises gradually,
but move up each day, so you can reach the goal of
50 in a sitting and 100 per day within 30 days.
3. P.C. squeeze inhales,
same as in the first P.C. squeeze however
you will being doing it to a slow inhale,
strongly squeezing during the entire inhalation
of about 10 seconds.
Goal; 20 twice daily.
Again, start slowly but keep the goal of 20 in mind at the
end of 30 days.
The above exercises we know, seem to be a time consuming chore
at this point & time, and the numbers seem astronomical.
However, as you will soon see, they will reap wondrous rewards!
A tip for you, is to do them mixed.
For example; ( Squeeze, Pushout, Squeeze inhale).
Regardless of how you choose to do them, you will find that they
can be done fairly quickly while watching
Television or during other activities.
We would recommend that you do these exercises for
about 8 days skipping a day between each session
before you proceed to the section following,
which will show you how to use the muscles
in conjunction with climax & ejaculation control.
1__ day
2 __ dayz
3 __ dayz
4 __ dayz
5 __ dayz
6 __dayz
7 __ dayz
8 __ dayz
SECTION 4 Multigasm (the one hour joyride)
Ejaculation Control
Before we begin, you have a decision to make.
If you have a partner, you can practice these methods
of control during sexual sessions with them.
But know that they are more effectively learned
by solo exploration.
A compromise, is that you can alternate with
solo & partner sessions.
We will be using two basic methods of control here before we
move on to the P.C. control.
These exercises will serve you in learning to recognize the three
zones of pleasure as you rise up the hill to climax, &
then to stop the ride,
before you reach the peak.
Zone 1 lasts the longest & starts from the time you begin
stimulation, to the time where it begins to feel really good prior to
the ejaculation zone.
Zone 2 lasts the second longest, & is characterized by that
really good feeling we get, right before we peak into climax.
Zone 3 is, as you've guessed, the time when we are ejaculating.
The goal right now is to target the beginning
phase of zone 2.
Then with practice, to ride that zone all the way into the end
and remain in control as we go over the peak.
Eventually we will be able to stay in that delicious zone for as
long as we desire.
The beginning methods are as follows;
1. Halting stimulation. This simply means to halt the
stroke & remain still until you once again feel in control.
2) Glans or (head) pinches of the penis.
Gently but firmly pinching the head
thumb on the top & two fingers on the bottom to
(shrink) it by pushing some of the engorged blood
back into the shaft.
This will halt orgasm.
However if you are too late, please don't try to
use this as a method
of keeping the semen in the penis, attempt a P.C. squeeze so
you will have the fuel for another try.
We will begin on the next page,........................................
After one of your external muscle exercise days, begin this new
practice ,
try a few head pinches,
notice how the head shrinks then re-inflates.
Okay now, after about 30 minutes of slow, safe,
stimulation, go for the 2nd zone, and when you first
feel that good feeling, stop stimulation and pause
until you once again have complete control.
If by chance you lose control, squeeze the P.C. muscle as hard
as you can, while holding your breath, & note how much fluid
you were not able to retain.
If too much was uncontrollably expelled, then you should
step up your internal exercise reps.
When the contractions are about over, resume stimulation.
If your glans is too sensitive, stimulate the shaft & testicles only,
for a while until you can once again without sensitivity,
touch the head.
If you are not able to retain your erection, don't worry,
try again later,
or wait until your next external muscle exercise day.
If you can, retain your erection, Attempt to build yourself back
up slowly to the 2nd zone, but if you cannot, don't despair,
you are still learning
& soon you will be able to accomplish it.
If you are able to regain the 2nd zone, ride it
teasingly for 2 seconds
then try a head pinch once or twice until you have control.
Again, if you go too far, utilize the P.C. squeeze then follow
through again the slow stimulation of testicles & shaft only if the
head is too sensitive, then Go again, if you are able & build to the
2nd zone, do the head squeeze again when you sense
yourself losing control.
When you know you have control again,
start stimulation again,
and if you carried through without having to P.C.
squeeze until this point...,
Go to the end of zone 2 then apply the P.C. squeeze with all your
might, breath held, while halting stimulation, & when the
contractions have stopped,... go back through the steps to try for
another orgasm in which you will apply the P.C. squeeze,
then quit for the day.
Do this exercise after the external exercises for 2 weeks before
you move onto the next step.
Which is Zone Surfing,..
Zone 2 Surfing
Again, after one of your weight exercises, go for a 30 minute
or more manipulation.
Enjoy yourself & take your time but stay clear of the 2nd zone.
After the allotted time, go cautiously for zone 2.
In zone 2 go for the center of the zone,
then try a P.C. squeeze
while you cease stimulation & notice if you return
to zone 1 quickly.
Go back for zone 2, this time in the middle try a P.C.
inhale & open it up.
Notice if this halts ejaculation or brings it on.
If it brings it on, immediately squeeze the P.C. &
retain as much fluid as you possibly can.
The purpose of these exercises is to find you what method
will work for you.
Everyone responds to one or the other, some to both.
Practice you're preferred method for 3 weeks, learning to ride
zone 2 as far as you can before utilizing the control.
If you can go to within a second before ejaculation
and retain control,
you will have made a big leap toward your ultimate goal,
because that one second gap will allow you to have a "dry
orgasm"
in which a full climax is achieved without ejaculation.
As always if you lose control then retain as much fluid as you
can at least twice before you end your session.
Next,.. Sail the Zone,..
Zone2 sailing
"Look, ........... no hands !!"
Okay, now. You have progressed far !
Now you can go to the final level, in control.
In this level you will utilize the "no hands" technique
of the "Masters !!"
Begin as always after an exercise session.
Zone one for at least 30 mins, then in the 2nd zone, sail as far as
you can, jerking the skin to the head or whatever method you
use for stimulation,
until you feel yourself ready to explode, then p.c. squeeze or p.c.
open , pause for a few seconds and jerk again to the apex,
and repeat the cycle for as long as you can.
Notice that you will be able to go further & further each day until
one day you will sail around the world.
The goal is to remain at the tip of the hill without falling over
into descent. In the beginning, you will most likely go too far &
have a short orgasm which will release some fluid, this is normal &
as long as you remain P.C. closed, as your ejaculate, you can try
again very soon.
This is a great time to begin working your new found
strength & control with your partner.
Remember, the key to this "sailing" technique is to continue
cautious stimulation, & try to remain at the peak.
This is your exercise now,... and from now on,... after external
muscle building or with your partner.
However with your partner, at the end of your session,
ejaculate & release some or all your fluid without control if you
wish, but keep in mind that this will lower your sex drive more so
than if you retain some fluid.
With your partner, now you have two very powerful methods
of control that you can utilize.
Whether you want to have 3 or more orgasms, or you want to sail
zone 2, or do both, it's all up to you friend.
The power is yours, enjoy !!
Now you're ready to learn the moves that will make you an
unforgettable lover !!
SECTION 5. Master strokes. (Moves to do the job.)
THE MOTION OF THE OCEAN
It's a hot summer night in 1972, and I'm in my neighborhood,
an area of mostly Americans of African descent.
My partners and I are attending a Saturday night basement party in
which we have paid our 25-cent entry fee.
Under a red light, in a humid room packed full of couples slow
dancing to that famous love song group the "Delfonics",
I have just made the girl I am dancing with, climax
for the 3rd time in four songs just by my "moves"
against her hot body.
All of us teenagers are doing a very sexual dance that has been
prevalent in the community since I can remember, and from what I
understand, it originated in Africa Centuries ago.
It was whispered about in hushed excitement whenever the older
adults weren't around and was practiced as a form of safe sex for
women & a means of getting the women "Hot" by the men.
The then current name of this dance was the "Grind" & it's
basically fully clothed 'Sex'.
The essence of this dance is a secret as to why Black men hold
a mystique around the world in the arena of sexual prowess.
In my travels around the world, I have encountered
many Women from many diverse cultures,
who to my amazement were very curious about
and eager to have sex with me.
This is because of the stories that pass around from person to
person about the sexuality of the Black man.
Women pass the stories along about "Great Sexual Passion and
Lust that melted their hearts and wills,"....
Men on the other hand distort the stories bring it down to
"Penis Size"
which is a falsehood !
Oh, you thought it was our mythical third limb ?
Are the stories
about our Huge penis true ?
No I say, & I can speak for more than just me,..
For I have lived in close quarters with thousands
of Black men and men of all "races" from all over the globe while I
served those many years
in the Armed Forces, &
I've been part of many a "long time no port Orgies"
where up to 15 men, pay for up to 30 women,
in a huge hotel room,
and "go at it all night,"
ordering food and drink as we enjoy ourselves.
So believe me when I tell you that Size doesn't run in "races".
"So" some ask, " are you sure that it isn't
Great oral sex that's your secret ?"
No !
There's a long running joke in Black neighborhoods about the
man who has to resort to " Eating that Putang"( oral sex )
to satisfy their women.
Hmmm, what are the secrets that we hold dear like a winning
hand of cards ?
The origin starts in Africa & is set in motion by the Drum.
The great secrets are "Movement, Positioning & Speed" &
they can be learned No matter what your culture of origin is.
To begin, you need to first remember that the first two inches
of a woman's vagina holds most of her pleasure nerves.
So the three very important African factors must come
into play here ;
1) Speed; strokes should be at a speed where she can feel it. Most
men make the mistake of pounding away at a furious pace.
This is a waste of time in most cases unless it is done
at the right time & I'll explain why.
We have interviewed hundreds of women on this subject
and with the exception of the very few who have
been abused for so many years, their nerves have
been numbed to the point of feeling only the most
rough stimulation,...................................................
For the vast majority of women, except for the
few seconds right before she climaxes, the bang, bang,
bang, style of love making
ranges from painful, to just plain boring
simply because feeling usually
shuts down, as soon as he starts the pounding !
Please read this section carefully and remember it !!
We cannot stress this subject enough.
Skin carried sexual feeling to the brain 10 times more
efficiently when it is stimulated at a slower rate.
Take this test, Please,..
and you will learn a very important lesson
that will move you miles ahead of most men on the road to being
the lover that Women Crave.
Next time you Begin' a session,... as soon as you achieve erection,
place both non-lubricated hands on top of one another in fists,
so there is a continual hole' that runs through both.
Now push your penis through your fists roughly and fast all the
way to the base at least 10 times as if you were 'fucking' someone.
Feel the danger of tearing your skin ?
Feel the pain as the fists bang into your family jewels, your balls'?
Does this feel very Sexual' to you? Hate it?
Unless of course you're deeply into Sado Masochism.
That is exactly what women feel,...and more,.....
keep in mind that our skin as men, is on the outside and
is dry and tough in comparison .
Women on the other hand, their organs are on the inside,
wet and tender as a rose pedal.
Doesn't take a genius to figure out the tearing,
as well as the pounding
of the reproductive organs (ovaries) that women can feel.
Is the same as shaft tearing and ball pounding.
Keep this in mind at all times when you enter them.
Women want when you are in them to move lovingly & need to
feel
that skin on skin rubbing to start that fire.
Women hate the wham bam' man.
So whether you are having a short hot "Quickie" or a long
passionate all niter, work with controlled passion' instead of
aggressive banging.
See the sex act as a race, in which you will pace yourself, starting
slowly, then moving a little faster in the middle, then at the end
go all out & win the race.
A partial exception to this rule, is where the Female is already
very hot, wet, & loose, and Burning passion must be quenched
within a short period of time.
However, read on to find out how to get the best
results from this situation.
2. Angle of attack; In the vagina about 1-1/2 to 2 inches inside,
the upper wall at from either 11 o'clock to 1 o'clock but normally
at the 12 o'clock position lies the vaginal orgasmic trigger.
To stimulate it, requires 1st the knowledge of its position, then
the best angles of penile thrusting, to stimulate it.
The favored position in the Afro American community
is the ‘Doggy Style'.
This position is fantastic for more reasons than any other.
A. It rubs the head of the penis directly on the vaginal trigger
when the man pulls almost all the way out on his stroke.
B) It gives the man & woman a lot of control as to where they want
to aim the strokes, and allows that circular movement
that women most women interviewed, love.
Circular movement is rotating the hips in a circle during the stroke,
either from side to side or up & down or a combo of both.
D. Ultimate deepness or shallow thrusting is all under control.
All positions where the man is behind or to the side will afford
you great angles of thrusting & more importantly for you,
it will allow you to pace yourself to utilize your
CLIMAX CONTROL TECHNIQUES.
However Any position can be utilized & made to work for you
if you keep the 1st 2 inches in mind while you do your
stroking & Unless your mate is versed in the
Female form of JOJIDO,
you must remain the
GUARDIAN of the thrust.
A huge advantage of face to face intercourse is that eye to eye
contact that you can have.
This can be very important to some females as it gives a feeling
of extra togetherness.
Another plus for the face to face is the ability to easily kiss,
a factor not to be taken lightly, especially at the moment
of her climax.
3. length of stroke; The head of the penis was designed not only
ease of penetration, & for our own stimulation but to
drive the female crazy.
Therefor your stroke should be designed to do exactly that !!
Certain women have not learned to climax vaginally but with a
new method you are about to learn, this will not be a factor and
soon she should be able to make the connection and break that
vaginal climax barrier.
Use your strokes at first shallowly !
This serves two very important functions.
1. In the beginning the female needs to be
opened slowly & tenderly like a flower opens to the
sunlight in the dawn !
Too fast an opening will wilt the flower, so go slow and
use the head of the penis to do what it was designed to do.
What is called the "Sausage & Bun" or S.B. & is designed to
bring climax to those clitoris climax only females.
Use your penis head to rub along the length of the vagina
up and down from the opening to the clitoris at a speed of about 2
seconds for the up & 2 down.
This is best done from the back, or doggy position because you
can, depending on the type of erection you have, do this hands
free, but if you must use your hands, this is normal too.
Do this for as long as you can, until she is begging you enter
her, then push only the head in the opening, back out & in only the
head, letting her feel the delicious feeling of the initial penetration
over & over.
Then repeat the S.B. pull out & slide the head up & down the
outside up to her clitoris & repeat for a while,
then return to the penetration,
but this time go a little deeper but not past 2 inches.
Stay in control no matter what she says, no matter how she
begs, you must be the master of the session.
She will thank you later Guaranteed !!
Slowly increase your depth until you are all the way inside
of her as if digging a hole a bit at a time, then when you reach
all the way to the hilt, alternate shallow strokes with deep & S.B.
& move to a slightly faster speed as you feel
her excitement building.
Don't forget your Climax control skills.
When you feel her getting ready to explode, you can either,
cease stimulation, & pause then stroke the fire back up to full
flame, or give her that furious, but controlled circular thrusting.
Note, that if you delay her gratification a few times, her climax
will be of a GREATER FORCE !!.
NEXT;....... THE MASTER STROKE !
THE ULTIMATE MASTER TECHNIQUE
This last stimulation technique will make her feel your penis to
the maximum when inside of her.
This all important technique was learned from a man who made
his living for 20 years as a Gentle Pimp.
I say "gentle" because, he never had to resort to violence to
keep his women happy and to stay with him.
He utilized his lovemaking skills which had to be extraordinary
when you consider he made love to women that had been working
with their vaginas all day or night & were by the time
he got to them,..
fairly Numb.
This technique kept his women with him for year after year,
very satisfied sexually. Though I do not condone his occupation,
I must give him the credit he so justly deserves !
" Thank you Slim, this is dedicated to you. "
This is a quite simple trick actually, but oh so effective.
You see usually, as you thrust, the very flexible skin of the penis is
usually gripped by the mouth of the vagina,
thus the only stimulation
the woman gets is from the head of the penis.
This technique will change all that.
As you're thrusting, hold your penis at the base with the thumb
on top of the penis & two fingers on the bottom tube
& push your fingers
in towards the scrotum.
This will swell the head shaft & veins of the whole
organ if you push
out & squeeze the PCs,...
additionally it will hold the skin taunt over the shaft so the whole
penis will slide in & out of her vagina,...
increasing her stimulation by giving her the extra friction of
all the skin & veins of the shaft going
in & out,..
On top of which the ballooning effect of the penis head
will drive her CRAZY !!
Two drawbacks to having your hand in the way is it will
shorten your thrusting length & stop you from using both hands
from feeling her whole body as you make love to her.
So we have developed a " HANDS FREE" way for you to
accomplish this move.
It is a simple device that can be worn the whole time,
safely & with comfort.
For more information e-mail us. At enlarge@earthlink.net
CONGRADULATIONS !!!!
You have completed a course that has turned you into a
" World Class Lover !!"
YOU have earned your Black Belt in JOJIDO !!
Use your skills responsibly & please be careful of the life
threatening Diseases that are running rampant out there !
If you know a Woman that you want to learn female version of
this course, please E-mail us.
Also if by chance you would like to order the Full penis exerciser
or the Hands free device, you qualify for a 25% discount on any
first time purchase of a product that we develop, including the
upcoming "Supra Advanced " course., and the Female version.
Thanks so much for giving us the opportunity to help you !!
We welcome you to the Zenno Jojido Society.
Sincerely,...
The World Wise people